Recombinant MPXV H3L Protein, >95% (SDS-PAGE)

Cat. No.: rp155938
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
Q8V4Z2
Protein Tag
C-His
Expression system
HEK293
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp155938-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
219,90US$
100μg
rp155938-100μg
1
879,90US$
1mg
rp155938-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
5.499,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) Animal Free,Azide Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
The monkeypox virus is the causative agent of the infectious disease of monkeypox. The virus is a member of the Orthopoxvirus genus in the family Poxviridae. And its genome is a double-stranded DNA. The disease caused by the virus is similar to but milder than smallpox and its mortality is often much lower. Humans and animals are both hosts for monkeypox virus and both species are vulnerable to the virus and may develop diseases. Monkeypox virus is mainly distributed in rainforests of west and central Africa. Isolates from Central Africa and Western Africa is different in virulence and the former is more virulent than the latter. The virus could spread in animals and humans and direct contact with the body fluid of an infected animal or being bitten may infect the virus.

Specifications

Product Name
Recombinant MPXV H3L Protein, >95% (SDS-PAGE)
Sinónimos
Monkeypox Virus | MPV | MPXV | H3L | IMV heparin binding surface protein | OPG108
Grado
Animal Free, Azide Free, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)
Pureza
>95% (SDS-PAGE)
Sistema de expresión
HEK293
Especie
Monkeypox virus
Aminoácidos
1-278 aa
Secuencia
MAAAKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMQEKRDVVIVNDDPDHYKDYVFIQWTGGNIRDDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSKFFIELENKNVEYVVIIENDNVIEDITFLRPVLKAIHDKKIDILQMREIITGNKVKTELVIDKDHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQIMDNSAKYVEHDPRLVAEHRFETMKPNFWSRIGTVAAKRYPGVMYTFTTPENLYFQGHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
33.9 kDa
SDS-PAGE
36.8 kDa, reducing conditions; 36.8 kDa, non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle.
Imágenes

Recombinant MPVX H3L Protein (rp155938) - SDS-PAGE
3 μg/lane of Recombinant MPVX H3L Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 36.8 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

1 results found

Lot NumberCertificate TypeFechaArticulo
ZJ23F0700581Certificate of AnalysisJul 14, 2023 rp155938
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.