Recombinant Protein A/G (Cy3)

Cat. No.: rp302416
Disponible para pedir
GRADE & PURITY Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. 1.0 mg/mL
Accession #
P19909,P02976
Protein Tag
No tag
Expression system
E. coli
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
100μg
rp302416-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
109,90US$
500μg
rp302416-500μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
299,90US$
1mg
rp302416-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
479,90US$
5mg
rp302416-5mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
1.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Bioactive, 1.0 mg/mL Bioactive for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at 2-8°C,Protected from light Ships Wet ice Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

The recombinant Protein A/G is a genetically engineered protein containing 5 IgG-binding regions of protein A and 2 of protein G. Cell wall binding region, cell membrane binding region and albumin binding region have been removed from the recombinant A/G-Cys to ensure the maximum specific IgG binding. The recombinant Protein A/G is ideal for making affinity gel to purification of polyclonal or monoclonal IgG antibodies. Protein A/G binds to various human, mouse and rat IgG subclasses (e.g., human IgG1, IgG2, IgG3, IgG4; mouse IgG2a, IgG2b, IgG3; rat IgG2a, IgG2c). It also binds to total IgG from cow, goat, sheep, house, rabbit, guinea pig, pig, dog and cat.
Cy3 protein A/G is a red fluorescent protein A/G conjugate that has excitation/emission wavelength at 554 nm/566 nm. All our protein A/G conjugates were purified by size exclusion chromatography to remove non-conjugated molecules and ensure adequate applications both in-vitro and in-vivo.

Specifications

Product Name
Recombinant Protein A/G (Cy3)
Sinónimos
Protein A/G-Cy3 | Recombinant Protein A/G-Cy3 | CY3-Recombinant Protein A/G | Recombinant protein A/G, Cy3 conjugated | reProtein A/G-Cy3
Grado
Bioactive
Especificaciones y pureza
Bioactive, 1.0 mg/mL
Mecanismos bioquímicos y fisiológicos
Plays a role in the inhibition of the host innate and adaptive immune responses. Possesses five immunoglobulin-binding domains that capture both the fragment crystallizable region (Fc region) and the Fab region (part of Ig that identifies antigen) of immu
Aminoácidos
35-330 aa & 373-497 aa
Secuencia
NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDSLEGSGSGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Conjugación
Cy3
Excitación (nm)
Green Laser(532nm)
Emisión (nm)
566nm
Ex/Em(nm)
Número de adhesión
Peso molecular previsto
48 kDa
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
1.0 mg/mL
Condiciones de almacenamiento de almacenamiento
Store at 2-8°C,Protected from light
Enviado en
Wet ice
Estabilidad y almacenamiento
The solution should be stored undiluted between 2°C and 8°C, and protected from prolonged exposure to light.
Imágenes

Recombinant Protein A/G (Cy3) (rp302416) - IF/ICC
IF analysis of EpCAM (red) in HT-29 cells. The cells were fixed with 4% Paraformaldehyde Fix Solution (P395744) for 15 minutes, and blocked with 5% BSA for 1 hour at room temperature. Cells were stained with Citatuzumab (anti-EpCAM) (Ab209902) at 1/1000 dilution in blocking buffer overnight at 4°C, and then incubated with Recombinant Protein A/G (Cy3) (rp302416) at a dilution of 1/2000 for 1 hour at room temperature in the dark (red). Cells were counterstained with DAPI (blue). Images were taken on the confocal laser scanning microscope.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F1028413Certificate of AnalysisJul 07, 2026 rp302416
ZJ25F1028414Certificate of AnalysisJul 07, 2026 rp302416
ZJ26F0333192Certificate of AnalysisMar 18, 2026 rp302416
ZJ26F0333191Certificate of AnalysisMar 18, 2026 rp302416
ZJ26F0333190Certificate of AnalysisMar 18, 2026 rp302416
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Bioactive grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.