Recombinant Protein A/G (Cy3)

Cat. No.: rp302416

GRADE & PURITY Bioactive, 1.0 mg/mL

Accession #

P19909,P02976

Protein Tag

No tag

Expression system

E. coli

Descripción general

The recombinant Protein A/G is a genetically engineered protein containing 5 IgG-binding regions of protein A and 2 of protein G. Cell wall binding region, cell membrane binding region and albumin binding region have been removed from the recombinant A/G-Cys to ensure the maximum specific IgG binding. The recombinant Protein A/G is ideal for making affinity gel to purification of polyclonal or monoclonal IgG antibodies. Protein A/G binds to various human, mouse and rat IgG subclasses (e.g., human IgG1, IgG2, IgG3, IgG4; mouse IgG2a, IgG2b, IgG3; rat IgG2a, IgG2c). It also binds to total IgG from cow, goat, sheep, house, rabbit, guinea pig, pig, dog and cat.
Cy3 protein A/G is a red fluorescent protein A/G conjugate that has excitation/emission wavelength at 554 nm/566 nm. All our protein A/G conjugates were purified by size exclusion chromatography to remove non-conjugated molecules and ensure adequate applications both in-vitro and in-vivo.

Specifications

Product Name

Recombinant Protein A/G (Cy3)

Sinónimos

Protein A/G-Cy3 | Recombinant Protein A/G-Cy3 | CY3-Recombinant Protein A/G | Recombinant protein A/G, Cy3 conjugated | reProtein A/G-Cy3

Grado

Bioactive

Especificaciones y pureza

Bioactive, 1.0 mg/mL

Mecanismos bioquímicos y fisiológicos

Plays a role in the inhibition of the host innate and adaptive immune responses. Possesses five immunoglobulin-binding domains that capture both the fragment crystallizable region (Fc region) and the Fab region (part of Ig that identifies antigen) of immu

Aminoácidos

35-330 aa & 373-497 aa

Secuencia

NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDSLEGSGSGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE

Conjugación

Cy3

Excitación (nm)

Green Laser(532nm)

Emisión (nm)

566nm

Ex/Em(nm)

Número de adhesión

P19909, P02976

Peso molecular previsto

48 kDa

Tipo de molécula

Protein

Almacenamiento y envío

Concentración

1.0 mg/mL

Condiciones de almacenamiento de almacenamiento

Store at 2-8°C,Protected from light

Enviado en

Wet ice

Estabilidad y almacenamiento

The solution should be stored undiluted between 2°C and 8°C, and protected from prolonged exposure to light.

Imágenes

IF/ICC : Recombinant Protein A/G (Cy3) (rp302416)

Recombinant Protein A/G (Cy3) (rp302416) - IF/ICC
IF analysis of EpCAM (red) in HT-29 cells. The cells were fixed with 4% Paraformaldehyde Fix Solution (P395744) for 15 minutes, and blocked with 5% BSA for 1 hour at room temperature. Cells were stained with Citatuzumab (anti-EpCAM) (Ab209902) at 1/1000 dilution in blocking buffer overnight at 4°C, and then incubated with Recombinant Protein A/G (Cy3) (rp302416) at a dilution of 1/2000 for 1 hour at room temperature in the dark (red). Cells were counterstained with DAPI (blue). Images were taken on the confocal laser scanning microscope.