Recombinant Protein A/G, HRP conjugate

Cat. No.: rp303272
Disponible para pedir
GRADE & PURITY BioReagent ? BioReagent grade — tested suitable for life-science and molecular-biology use. Use for cell culture, assays, and biochemical work needing biological compatibility. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. for Western blot ? Western-blot grade — suited to protein transfer and immunodetection. Use in Western workflows where reagent purity keeps background low. for ELISA ? ELISA grade — low-background reagents validated for enzyme immunoassays. Use to build sensitive, reproducible ELISA assays. Suitable for Immunohistochemistry(IHC) ? IHC grade — validated for immunohistochemistry on tissue sections. Use to detect and localize antigens in fixed tissue. 1.0 mg/mL
Accession #
P19909,P02976
Protein Tag
No tag
Expression system
E. coli
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
100μg
rp303272-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
29,90US$
500μg
rp303272-500μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
99,90US$
1mg
rp303272-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
169,90US$
5mg
rp303272-5mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
479,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

BioReagent,Azide Free,High Performance,for western blot,for ELISA,Suitable for Immunohistochemistry(IHC),1.0 mg/mL Azide Free,BioReagent,for ELISA,for Western blot,High Performance,Suitable for Immunohistochemistry(IHC) for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Protected from light,Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Aladdin offers recombinant protein A/G conjugated to our LumiDye™ AF Dyes (Table 1).

Table 1. Spectral characteristics of protein A/g conjugates.

Cat.No.Conjugateλmax (nm)Em (nm
rp303272HRPNANA
rp303273FITC498517
rp303275AF488490525
rp303276AF555553568
rp303277AF594590618
rp303278AF647650668
rp302416Cy3554566

Aladdin recombinant Protein A/G is a genetically engineered protein containing 5 IgG-binding regions of protein A and 2 of protein G. Cell wall binding region, cell membrane binding region and albumin binding region have been removed from the recombinant A/G-Cys to ensure the maximum specific IgG binding. The recombinant Protein A/G is ideal for making affinity gel to purification of polyclonal or monoclonal IgG antibodies. Protein A/G binds to various human, mouse and rat IgG subclasses (e.g., human IgG1, IgG2, IgG3, IgG4; mouse IgG2a, IgG2b, IgG3; rat IgG2a, IgG2c). It also binds to total IgG from cow, goat, sheep, house, rabbit, guinea pig, pig, dog and cat.

 

We have detected the binding data of different IgG subtypes with recombinant protein A/G, as shown in the Graph1.

Graph 1. Protein A/G affinity to selected species.

Recombinant Protein A/G is covalently conjugated to HRP, followed by size‑exclusion chromatography to remove most unreacted proteins and free HRP, yielding a high‑quality conjugate. It is used for probing and antibody detection in Western blotting (WB), enzyme‑linked immunosorbent assay (ELISA), immunohistochemistry (IHC), Immunoprecipitation(IP) and other immunoassay protocols, and is especially suitable for IgG antibodies from a wide range of host species.

Specifications

Product Name
Recombinant Protein A/G, HRP conjugate
Sinónimos
Protein A/G, horseradish peroxidase conjugated | Protein A/G-HRP | Protein A/G-Peroxidase | Horseradish Peroxidase-labeled Protein A/G | HRP-labeled Protein A/G | HRP-Protein A/G
Grado
Azide Free, BioReagent, for ELISA, for Western blot, High Performance, Suitable for Immunohistochemistry(IHC)
Especificaciones y pureza
BioReagent, Azide Free, High Performance, for western blot, for ELISA, Suitable for Immunohistochemistry(IHC), 1.0 mg/mL
Mecanismos bioquímicos y fisiológicos
Plays a role in the inhibition of the host innate and adaptive immune responses. Possesses five immunoglobulin-binding domains that capture both the fragment crystallizable region (Fc region) and the Fab region (part of Ig that identifies antigen) of immu
Aminoácidos
35-330 aa & 373-497 aa
Secuencia
NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDSLEGSGSGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Conjugación
HRP
Número de adhesión
Nota
Because staining protocols vary with application, the appropriate dilution of the protein A conjugates should be determined empirically.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
1.0 mg/mL
Condiciones de almacenamiento de almacenamiento
Protected from light,Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at-20°C for one year. Avoid repeated freeze/thaw cycles. Protect from light.
Imágenes
Recombinant Protein A/G, HRP conjugate (rp303272) - Western Blot 
All lanes: SDHA Mouse mAb (Ab126844) at 1/1000 dilution 
Samples: Lysates at 20 µg per lane 
Secondary: Recombinant Protein A/G, HRP conjugate (rp303272) at 1/20000 dilution 
Predicted band size: 70 kDa 
Observed band size: 66 kDa 
Exposure time: 69.8 s
Recombinant Protein A/G, HRP conjugate (rp303272) - Western Blot 
All lanes: Aldolase C Mouse mAb (Ab088122) at 1/1000 dilution 
Samples: Lysates at 20 µg per lane 
Secondary: Recombinant Protein A/G, HRP conjugate (rp303272) at 1/20000 dilution 
Predicted band size: 39 kDa 
Observed band size: 39 kDa 
Exposure time: 19.8 s
Aplicación
AplicaciónDilution info
ELISA

1/5000-1/100000

WB

1/2000-1/20000

IP

1:2000-1:20000

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0434798Certificate of AnalysisApr 28, 2026 rp303272
ZJ26F0434799Certificate of AnalysisApr 28, 2026 rp303272
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.