Recombinant Protein A, Long Form, CAS No.91932-65-9

CAS: 91932-65-9 Cat. No.: rp224628 Número EC: 295-242-9 PubChem CID: 363902062
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. ≥97%(SDS-PAGE&SEC-HPLC)
Accession #
E5R5N7
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10mg
rp224628-10mg
2
105,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free, Carrier Free, ≥97%(SDS-PAGE&SEC-HPLC) Animal Free,Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 4 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Protein A is a cell wall component produced by several strains of Staphylococcus aureus that consists of a single polypeptide chain and contains little or no carbohydrate. Recombinant Protein A is produced in E.Coli and functions essentially the same as native Protein A. It consists of 5 IgG-binding domains E-D-A-B-C aligned in series. Specificity: The recombinant Protein A is a genetically engineered protein containing 5 IgG-binding regions of protein A. The recombinant Protein A is ideal for purification of polyclonal or monoclonal IgG antibodies. Protein A binds to various human, mouse and rat IgG subclasses (e.g., human IgG1, IgG2, IgG4; mouse IgG2a, IgG2b, IgG3; rat IgG2c). It also binds to total IgG from rabbit, guinea pig, pig, dog and cat.

Specifications

Product Name
Recombinant Protein A, Long Form, CAS No.91932-65-9
Sinónimos
Recombinant Protein A | Protein A, Long Form | Protein A | Staphylococcal Protein A | Staphylococcal Protein A Recombinant | Immunoglobulin G-binding protein A | gG-binding protein A | Immunoglobulin G binding protein A | SPA | ECTR2_67
Grado
Animal Free, Carrier Free
Especificaciones y pureza
Animal Free, Carrier Free, ≥97%(SDS-PAGE&SEC-HPLC)
Concentración de endotoxinas
<0.1 EU/μg
Aminoácidos
37-458 aa
Secuencia
AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNKKPGKEDGNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVD
Número de adhesión
Peso molecular previsto
46.6 kDa
SDS-PAGE
46.6 kDa
CAS
91932-65-9
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
Dissolve in distilled water or saline.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-70℃ long term (12 months). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. 

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

1 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0926540Certificate of AnalysisJul 10, 2026 rp224628
Citations of This Product
Referencias
1. Li Yangyang, Zhu Zhengwei, Qu Wenli, Yang Qing, Liu Yan, Wang Qiao, Duan Shuo, Wu Jine, Gong Zhiyong, Xu Lin.  (2023)  A highly sensitive immunochromatographic assay for lead ions in drinking water based on antibody-oriented probe and silver enhancement.  EUROPEAN FOOD RESEARCH AND TECHNOLOGY,  249  (12): (3097-3103).  [PMID:] [10.1007/s00217-023-04351-5]
2. Jin Li, Xintong Li, Yulian Wang, Qianxu Zhou, Guoqing Shi.  (2024)  Utilization of Fc-specific peptide to orientally immobilize antibodies markedly improves the analytical performance of lateral flow immunoassay strips for aflatoxin B1.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2024.112404]
3. Shuo Yang, Jinglong Qu, Yang Qin, Shuaibing An, Kaiqiang Huang, Yaling Wei, Jun Xi.  (2026)  Enhanced ultra-sensitive detection of peanut allergen Ara h 3 on immunochromatographic paper based on surface-enhanced Raman spectroscopy and AuNBs@PDA dual signal amplification strategy.  FOOD CHEMISTRY,      [PMID:41638166] [10.1016/j.foodchem.2026.148209]
4. Pan Cheng, Chuang Zhang, Xiupu Lu, Daiqing Peng, Pengju Zhao, Tao Mei, Shunxing Zhang, Qihao Guo, Ke Liu, Dong Wang.  (2026)  Protein A functionalized hierarchically ordered nanofibrous sponge enabling high-efficiency IgG purification.  COLLOIDS AND SURFACES A-PHYSICOCHEMICAL AND ENGINEERING ASPECTS,      [PMID:] [10.1016/j.colsurfa.2026.140254]
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.