Staphylokinase (SAK) , CAS No.9040-61-3

CAS: 9040-61-3 Cat. No.: S1443162
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. Recombinant ? Recombinant — produced via recombinant expression for defined sequence and consistency. Use for reproducible, animal-free proteins of known origin. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥90%(SDS-PAGE) ≥50000 U/mg protein
Accession #
Q99SU7
Protein Tag
No tag
Expression system
E. coli
Bioactivity
The specific activity determined by fibrining lysis in agarose plate is 50000 IU/mg.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
20μg
S1443162-20μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
59,90US$
100μg
S1443162-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
139,90US$
1mg
S1443162-1mg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
919,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,Recombinant,ActiBioPure™,High Performance,≥90%(SDS-PAGE),≥50000 U/mg protein ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,Recombinant for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Staphylokinase, staphylococcus aureus (SAK) is a fibrin-specific plasminogen activator. Staphylokinase is an efficient, fibrin-selective thrombolytic agent.


Specifications

Product Name
Staphylokinase (SAK) , CAS No.9040-61-3
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, Recombinant
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, Recombinant, ActiBioPure™, High Performance, ≥90%(SDS-PAGE), ≥50000 U/mg protein
Mecanismos bioquímicos y fisiológicos
Potent plasminogen activator that converts plasminogen into plasmin. It forms a 1:1 complex with plasmin, which in turn activates other plasminogen molecules.
Bioactividad
The specific activity determined by fibrining lysis in agarose plate is 50000 IU/mg.
Aminoácidos
28-163 aa
Secuencia
SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDSKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Número de adhesión
Peso molecular previsto
15.5 kDa
SDS-PAGE
15 kDa, under reducing conditions.
Tipo de acción
ACTIVATOR
CAS
9040-61-3
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
≥50000 U/mg protein
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ long term (1 year). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. 

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0535784Certificate of AnalysisMay 29, 2026 S1443162
ZJ26F0535783Certificate of AnalysisMay 29, 2026 S1443162
ZJ26F0535782Certificate of AnalysisMay 29, 2026 S1443162
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.