224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Prolactin-inducible protein |
|---|
Gene and Protein Information
| Gene ID | 5304 |
|---|---|
| Uniprot Accession IDs | P12273 A0A963 A0A9C3 A0A9F3 A4D2I1 |
| Ensembl ID | ENSP00000291009 |
| Symbol | GCDFP15 GPIP4 GPIP4 GCDFP15 GCDFP-15 |
| Family | Belongs to the PIP family. |
| Sequence | MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 494144 | PIP | prolactin induced protein | 9598 | VGNC:8733 | Inparanoid, OMA, EggNOG |
| Mouse | 18716 | Pip | prolactin induced protein | 10090 | MGI:102696 | Inparanoid, OMA, EggNOG |
| Rat | 64673 | Pip | prolactin induced protein | 10116 | RGD:70946 | Inparanoid, OMA, EggNOG |
| Dog | 608856 | PIP | prolactin induced protein | 9615 | VGNC:44570 | Inparanoid, OMA, EggNOG |
| Horse | 100629611 | PIP | prolactin induced protein | 9796 | VGNC:21461 | Inparanoid, OMA, EggNOG |
| Cow | 613853 | PIP | prolactin induced protein | 9913 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.