Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha |
|---|
Gene and Protein Information
| Gene ID | 10554 |
|---|---|
| Uniprot Accession IDs | Q99943 A2BFI5 Q5BL03 |
| Ensembl ID | ENSP00000378877 |
| Symbol | G15 G15 LPAATA 1-AGPAT1 LPAAT-alpha |
| Family | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. |
| Sequence | MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462582 | AGPAT1 | 1-acylglycerol-3-phosphate O-acyltransferase 1 | 9598 | VGNC:12570 | OMA, EggNOG |
| Macaque | 717174 | AGPAT1 | 1-acylglycerol-3-phosphate O-acyltransferase 1 | 9544 | Inparanoid, OMA | |
| Mouse | 55979 | Agpat1 | 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) | 10090 | MGI:1932075 | Inparanoid, OMA |
| Rat | 406165 | Agpat1 | 1-acylglycerol-3-phosphate O-acyltransferase 1 | 10116 | RGD:1303287 | Inparanoid, OMA |
| Dog | 474857 | AGPAT1 | 1-acylglycerol-3-phosphate O-acyltransferase 1 | 9615 | VGNC:37710 | Inparanoid, OMA |
| Horse | 100059501 | AGPAT1 | 1-acylglycerol-3-phosphate O-acyltransferase 1 | 9796 | VGNC:15165 | Inparanoid, OMA |
| Cow | 282137 | AGPAT1 | 1-acylglycerol-3-phosphate O-acyltransferase 1 | 9913 | VGNC:25734 | Inparanoid, OMA |
| Pig | 613128 | AGPAT1 | 1-acylglycerol-3-phosphate O-acyltransferase 1 | 9823 | Inparanoid, OMA | |
| Opossum | AGPAT1 | 1-acylglycerol-3-phosphate O-acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:324] | 13616 | Inparanoid, OMA | ||
| Xenopus | 100037898 | agpat1 | 1-acylglycerol-3-phosphate O-acyltransferase 1 | 8364 | XB-GENE-487933 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.