224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 |
|---|
Gene and Protein Information
| Gene ID | 55824 |
|---|---|
| Uniprot Accession IDs | Q9NWQ8 A8K1A3 Q2M1Z9 Q5BKU4 Q9NYK0 |
| Ensembl ID | ENSP00000220597 |
| Symbol | CBP PAG CBP PAG |
| Sequence | MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464253 | PAG1 | phosphoprotein membrane anchor with glycosphingolipid microdomains 1 | 9598 | VGNC:13199 | OMA, EggNOG |
| Macaque | 700748 | PAG1 | phosphoprotein membrane anchor with glycosphingolipid microdomains 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 94212 | Pag1 | phosphoprotein associated with glycosphingolipid microdomains 1 | 10090 | MGI:2443160 | Inparanoid, OMA, EggNOG |
| Rat | 64019 | Pag1 | phosphoprotein membrane anchor with glycosphingolipid microdomains 1 | 10116 | RGD:620394 | Inparanoid, OMA |
| Dog | 610895 | PAG1 | phosphoprotein membrane anchor with glycosphingolipid microdomains 1 | 9615 | VGNC:44242 | Inparanoid, OMA, EggNOG |
| Horse | 100050548 | PAG1 | phosphoprotein membrane anchor with glycosphingolipid microdomains 1 | 9796 | VGNC:21136 | Inparanoid, OMA, EggNOG |
| Cow | 614460 | PAG1 | phosphoprotein membrane anchor with glycosphingolipid microdomains 1 | 9913 | VGNC:32553 | OMA, EggNOG |
| Pig | 100157912 | PAG1 | phosphoprotein membrane anchor with glycosphingolipid microdomains 1 | 9823 | Inparanoid, EggNOG | |
| Opossum | 100019601 | PAG1 | phosphoprotein membrane anchor with glycosphingolipid microdomains 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100089568 | PAG1 | phosphoprotein membrane anchor with glycosphingolipid microdomains 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100559128 | pag1 | phosphoprotein membrane anchor with glycosphingolipid microdomains 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100380123 | pag1 | phosphoprotein membrane anchor with glycosphingolipid microdomains 1 | 8364 | XB-GENE-5852172 | Inparanoid, OMA, EggNOG |
| Zebrafish | 100034498 | pag1 | phosphoprotein membrane anchor with glycosphingolipid microdomains 1 | 7955 | ZDB-GENE-060503-586 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.