RBP4

DescripciónRetinol-binding protein 4

Gene and Protein Information

Gene ID5950
Uniprot Accession IDs P02753 D3DR38 O43478 O43479 Q5VY24 Q8WWA3 Q9P178
Ensembl ID ENSP00000360522
Symbol RDCCAS MCOPCB10
FamilyBelongs to the calycin superfamily. Lipocalin family.
Sequence
MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp450617RBP4retinol binding protein 49598VGNC:5717Inparanoid, OMA, EggNOG
Mouse19662Rbp4retinol binding protein 4, plasma10090MGI:97879Inparanoid, OMA, EggNOG
Rat25703Rbp4retinol binding protein 410116RGD:3546Inparanoid, OMA, EggNOG
Dog477775RBP4retinol binding protein 49615VGNC:45432Inparanoid, OMA, EggNOG
Horse100049790RBP4retinol binding protein 49796VGNC:49533Inparanoid, OMA, EggNOG
Cow281444RBP4retinol binding protein 49913VGNC:33815Inparanoid, OMA, EggNOG
Pig397124RBP4retinol binding protein 49823Inparanoid, OMA, EggNOG
Opossum100023751RBP4retinol binding protein 413616Inparanoid, EggNOG
Chicken396166RBP4Aretinol binding protein 4 A, plasma9031CGNC:49682Inparanoid, OMA, EggNOG
Anole lizard100566565rbp4retinol binding protein 428377Inparanoid, OMA
Xenopus548465rbp4retinol binding protein 48364XB-GENE-5841608Inparanoid, OMA
Zebrafish30077rbp4retinol binding protein 4, plasma7955ZDB-GENE-000210-19Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.