🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RAMP2

DescripciónReceptor activity-modifying protein 2

Gene and Protein Information

Gene ID10266
Uniprot Accession IDs O60895 A7L9S6 K7EMD3 Q8N1F2
Ensembl ID ENSP00000253796
FamilyBelongs to the RAMP family.
Sequence
MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp454698RAMP2receptor activity modifying protein 29598VGNC:9553OMA, EggNOG
Macaque707718RAMP2receptor activity modifying protein 29544Inparanoid, OMA, EggNOG
Mouse54409Ramp2receptor (calcitonin) activity modifying protein 210090MGI:1859650Inparanoid, OMA, EggNOG
Rat58966Ramp2receptor activity modifying protein 210116RGD:61872Inparanoid, OMA, EggNOG
Dog480515RAMP2receptor activity modifying protein 29615Inparanoid, OMA, EggNOG
HorseRAMP2receptor activity modifying protein 2 [Source:HGNC Symbol;Acc:HGNC:9844]9796OMA, EggNOG
Cow504230RAMP2receptor activity modifying protein 29913VGNC:33707Inparanoid, OMA, EggNOG
Pig397155RAMP2receptor activity modifying protein 29823Inparanoid, OMA, EggNOG
Opossum100011362RAMP2receptor activity modifying protein 213616Inparanoid, OMA, EggNOG
Chicken420022RAMP2receptor activity modifying protein 29031CGNC:17380Inparanoid, EggNOG
Anole lizardRAMP2receptor activity modifying protein 2 [Source:HGNC Symbol;Acc:HGNC:9844]28377Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.