🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RAMP1

DescripciónReceptor activity-modifying protein 1

Gene and Protein Information

Gene ID10267
Uniprot Accession IDs O60894 Q6FGS5
Ensembl ID ENSP00000254661
FamilyBelongs to the RAMP family.
Sequence
MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse51801Ramp1receptor (calcitonin) activity modifying protein 110090MGI:1858418Inparanoid, OMA, EggNOG
Rat58965Ramp1receptor activity modifying protein 110116RGD:61870Inparanoid, OMA, EggNOG
DogRAMP1receptor activity modifying protein 1 [Source:HGNC Symbol;Acc:HGNC:9843]9615OMA, EggNOG
Horse100066550RAMP1receptor activity modifying protein 19796VGNC:22168Inparanoid, OMA, EggNOG
Cow617017RAMP1receptor activity modifying protein 19913Inparanoid, EggNOG
Pig397401RAMP1receptor activity modifying protein 19823Inparanoid, OMA, EggNOG
Chicken424016RAMP1receptor activity modifying protein 19031CGNC:2798Inparanoid, OMA, EggNOG
Anole lizard100563905ramp1receptor activity modifying protein 128377Inparanoid, OMA, EggNOG
Xenopus780274ramp1receptor (G protein-coupled) activity modifying protein 18364XB-GENE-1010532Inparanoid, OMA, EggNOG
Zebrafish436966zgc:91818zgc:918187955ZDB-GENE-040718-446Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.