224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Renin |
|---|
Gene and Protein Information
| Gene ID | 5972 |
|---|---|
| Uniprot Accession IDs | P00797 Q6FI38 Q6T5C2 |
| Ensembl ID | ENSP00000272190 |
| Symbol | HNFJ2 |
| Family | Belongs to the peptidase A1 family. |
| Sequence | MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469651 | REN | renin | 9598 | VGNC:6977 | Inparanoid, OMA, EggNOG |
| Macaque | 574299 | REN | renin | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 19701 | Ren1 | renin 1 structural | 10090 | MGI:97898 | OMA, EggNOG |
| Rat | 24715 | Ren | renin | 10116 | RGD:3554 | Inparanoid, OMA, EggNOG |
| Dog | 403838 | REN | renin | 9615 | VGNC:45474 | Inparanoid, OMA, EggNOG |
| Horse | 100054248 | REN | renin | 9796 | VGNC:22299 | Inparanoid, OMA, EggNOG |
| Cow | 280909 | REN | renin | 9913 | VGNC:33865 | Inparanoid, OMA, EggNOG |
| Opossum | 100017089 | LOC100017089 | renin-like | 13616 | OMA, EggNOG | |
| Platypus | 100092330 | CTSE | cathepsin E | 9258 | OMA, EggNOG | |
| Anole lizard | 100557560 | ren | renin | 28377 | Inparanoid, OMA | |
| Xenopus | 100487524 | ren | renin | 8364 | XB-GENE-480535 | Inparanoid, OMA |
| Zebrafish | 405786 | ren | renin | 7955 | ZDB-GENE-040630-3 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.