🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

REL

DescripciónProto-oncogene c-Rel

Gene and Protein Information

Gene ID5966
Uniprot Accession IDs Q04864 Q17RU2 Q2PNZ7 Q6LDY0
Ensembl ID ENSP00000295025
Symbol C-Rel
Sequence
MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp470380RELREL proto-oncogene, NF-kB subunit9598VGNC:10284OMA, EggNOG
Macaque717804RELREL proto-oncogene, NF-kB subunit9544Inparanoid, OMA, EggNOG
Mouse19696Relreticuloendotheliosis oncogene10090MGI:97897Inparanoid, OMA, EggNOG
Rat305584RelREL proto-oncogene, NF-kB subunit10116RGD:1311231Inparanoid, OMA
Dog474606RELREL proto-oncogene, NF-kB subunit9615VGNC:45465Inparanoid, OMA, EggNOG
Horse100065217RELREL proto-oncogene, NF-kB subunit9796VGNC:22292Inparanoid, OMA, EggNOG
Cow509135RELREL proto-oncogene, NF-kB subunit9913VGNC:33857Inparanoid, OMA, EggNOG
Pig100525104RELREL proto-oncogene, NF-kB subunit9823Inparanoid, OMA, EggNOG
Opossum100033322RELREL proto-oncogene, NF-kB subunit13616Inparanoid, EggNOG
Platypus100081576RELREL proto-oncogene, NF-kB subunit9258Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.