🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PDCD6

DescripciónProgrammed cell death protein 6

Gene and Protein Information

Gene ID10016
Uniprot Accession IDs O75340 B2RD16 E7ESR3 Q2YDC2 Q5TZS0
Ensembl ID ENSP00000264933
Symbol ALG2 ALG2 ALG-2 PEF1B
Sequence
MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp471813PDCD6programmed cell death 69598VGNC:4123OMA, EggNOG
Mouse18570Pdcd6programmed cell death 610090MGI:109283Inparanoid, OMA, EggNOG
Rat308061Pdcd6programmed cell death 610116RGD:1311239Inparanoid, OMA, EggNOG
Dog609549PDCD6programmed cell death 69615VGNC:44340Inparanoid, OMA, EggNOG
HorsePDCD6programmed cell death 6 [Source:HGNC Symbol;Acc:HGNC:8765]9796OMA, EggNOG
Cow100125927PDCD6programmed cell death 69913VGNC:32663Inparanoid, OMA, EggNOG
Opossum100011306PDCD6programmed cell death 613616Inparanoid, OMA, EggNOG
Chicken420988PDCD6programmed cell death 69031CGNC:10082Inparanoid, OMA, EggNOG
Xenopus493366pdcd6programmed cell death 68364XB-GENE-960916Inparanoid, OMA, EggNOG
Zebrafish393925pdcd6programmed cell death 67955ZDB-GENE-040426-1307Inparanoid, OMA, EggNOG
C. elegans187448M04F3.4hypothetical protein6239OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.