COX6B1

DescripciónCytochrome c oxidase subunit 6B1

Gene and Protein Information

Gene ID1340
Uniprot Accession IDs P14854 B2R5C9 Q6IBL4
Ensembl ID ENSP00000246554
Symbol COX6B COXG COX6B COXVIb1
FamilyBelongs to the cytochrome c oxidase subunit 6B family.
Sequence
MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp745426COX6B1cytochrome c oxidase subunit 6B19598VGNC:7610OMA, EggNOG
Macaque692062COX6B1cytochrome c oxidase subunit 6B9544Inparanoid, OMA, EggNOG
Mouse110323Cox6b1cytochrome c oxidase, subunit VIb polypeptide 110090MGI:107460Inparanoid, OMA, EggNOG
RatCox6b1cytochrome c oxidase subunit 6B1 [Source:RGD Symbol;Acc:1584097]10116OMA, EggNOG
Dog612644LOC612644cytochrome c oxidase subunit 6B19615Inparanoid, OMA, EggNOG
Horse100051249COX6B1cytochrome c oxidase subunit 6B19796VGNC:16807Inparanoid, OMA, EggNOG
Pig100038022COX6BCOX6B protein9823Inparanoid, OMA, EggNOG
Opossum100013297LOC100013297cytochrome c oxidase subunit 6B113616OMA, EggNOG
Anole lizard100554634LOC100554634cytochrome c oxidase subunit 6B128377OMA, EggNOG
Zebrafish436968cox6b1cytochrome c oxidase subunit VIb polypeptide 17955ZDB-GENE-040718-448OMA, EggNOG
Zebrafish393478cox6b2cytochrome c oxidase subunit VIb polypeptide 27955ZDB-GENE-040426-1566Inparanoid, OMA
S.cerevisiae850727COX12cytochrome c oxidase subunit VIb4932S000004028OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.