The store will not work correctly when cookies are disabled.
Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
COX6B1 Descripción Cytochrome c oxidase subunit 6B1
Gene and Protein Information Gene ID 1340 Uniprot Accession IDs P14854 B2R5C9 Q6IBL4 Ensembl ID ENSP00000246554 Symbol COX6B COXG COX6B COXVIb1 Family Belongs to the cytochrome c oxidase subunit 6B family. Sequence MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Homologous gene and protein info.
Species Gene ID Gene Symbol Nombre NIF Other Gene ID Sources Chimp 745426 COX6B1 cytochrome c oxidase subunit 6B1 9598 VGNC:7610 OMA, EggNOG Macaque 692062 COX6B1 cytochrome c oxidase subunit 6B 9544 Inparanoid, OMA, EggNOG Mouse 110323 Cox6b1 cytochrome c oxidase, subunit VIb polypeptide 1 10090 MGI:107460 Inparanoid, OMA, EggNOG Rat Cox6b1 cytochrome c oxidase subunit 6B1 [Source:RGD Symbol;Acc:1584097] 10116 OMA, EggNOG Dog 612644 LOC612644 cytochrome c oxidase subunit 6B1 9615 Inparanoid, OMA, EggNOG Horse 100051249 COX6B1 cytochrome c oxidase subunit 6B1 9796 VGNC:16807 Inparanoid, OMA, EggNOG Pig 100038022 COX6B COX6B protein 9823 Inparanoid, OMA, EggNOG Opossum 100013297 LOC100013297 cytochrome c oxidase subunit 6B1 13616 OMA, EggNOG Anole lizard 100554634 LOC100554634 cytochrome c oxidase subunit 6B1 28377 OMA, EggNOG Zebrafish 436968 cox6b1 cytochrome c oxidase subunit VIb polypeptide 1 7955 ZDB-GENE-040718-448 OMA, EggNOG Zebrafish 393478 cox6b2 cytochrome c oxidase subunit VIb polypeptide 2 7955 ZDB-GENE-040426-1566 Inparanoid, OMA S.cerevisiae 850727 COX12 cytochrome c oxidase subunit VIb 4932 S000004028 OMA, EggNOG
Associated Recombinant Proteins Nombre Specification and purity Expression system Protein label Disponibilidad Mostrar detalles
Associated Antibodies
Nombre Specifications Species reactivity Aplicación Disponibilidad Mostrar detalles
Associated Approved Drugs Associated Active Ligands Associated Diseases Nombre Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Configuración Aceptar todo Rechazar
Shall we send you a message when we have discounts available?
Remind me later Permitir
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.