🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CRABP2

DescripciónCellular retinoic acid-binding protein 2

Gene and Protein Information

Gene ID1382
Uniprot Accession IDs P29373 B2R4Z8 D3DVC5 F1T098 Q6ICN6
Ensembl ID ENSP00000482841
Symbol RBP6 CRABP-II
FamilyBelongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence
MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp469838CRABP2cellular retinoic acid binding protein 29598VGNC:509OMA, EggNOG
Macaque718579CRABP2cellular retinoic acid binding protein 29544Inparanoid, OMA, EggNOG
Mouse12904Crabp2cellular retinoic acid binding protein II10090MGI:88491Inparanoid, OMA, EggNOG
Rat29563Crabp2cellular retinoic acid binding protein 210116RGD:62070Inparanoid, OMA, EggNOG
Dog612093CRABP2cellular retinoic acid binding protein 29615VGNC:39588Inparanoid, OMA, EggNOG
Horse100058072CRABP2cellular retinoic acid binding protein 29796VGNC:16847Inparanoid, OMA, EggNOG
Cow493998CRABP2cellular retinoic acid binding protein 29913VGNC:27686Inparanoid, OMA, EggNOG
Pig100155151CRABP2cellular retinoic acid binding protein 29823Inparanoid, OMA, EggNOG
Opossum100018489CRABP2cellular retinoic acid binding protein 213616Inparanoid, OMA, EggNOG
Anole lizard100556219crabp2cellular retinoic acid binding protein 228377Inparanoid, OMA
Xenopus448629crabp2cellular retinoic acid binding protein 28364XB-GENE-959098Inparanoid, OMA
Zebrafish503502crabp2bcellular retinoic acid binding protein 2, b7955ZDB-GENE-050208-52Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.