PELI1

DescripciónE3 ubiquitin-protein ligase pellino homolog 1

Gene and Protein Information

Gene ID57162
Uniprot Accession IDs Q96FA3 Q96SM0 Q9GZY5 Q9HCX0 Pellino-1
Ensembl ID ENSP00000351789
Symbol PRISM
FamilyBelongs to the pellino family.
Sequence
MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp746407PELI1pellino E3 ubiquitin protein ligase 19598VGNC:333OMA, EggNOG
Mouse67245Peli1pellino 110090MGI:1914495Inparanoid, OMA, EggNOG
Rat305549Peli1pellino E3 ubiquitin protein ligase 110116RGD:1311199Inparanoid, OMA
Dog481388PELI1pellino E3 ubiquitin protein ligase 19615VGNC:44414Inparanoid, OMA
Horse100051401PELI1pellino E3 ubiquitin protein ligase 19796VGNC:21305Inparanoid, OMA
Cow535054PELI1pellino E3 ubiquitin protein ligase 19913VGNC:32740Inparanoid, OMA
Platypus100078304PELI1pellino E3 ubiquitin protein ligase 19258Inparanoid, OMA
Chicken421279PELI1pellino E3 ubiquitin protein ligase 19031CGNC:51458Inparanoid, OMA
Anole lizard100553038peli1pellino E3 ubiquitin protein ligase 128377Inparanoid, OMA
Xenopus100125008peli2pellino E3 ubiquitin protein ligase family member 28364XB-GENE-992979Inparanoid, OMA
Zebrafish558420peli1bpellino E3 ubiquitin protein ligase 1b7955ZDB-GENE-061027-372Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.