224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | E3 ubiquitin-protein ligase pellino homolog 1 |
|---|
Gene and Protein Information
| Gene ID | 57162 |
|---|---|
| Uniprot Accession IDs | Q96FA3 Q96SM0 Q9GZY5 Q9HCX0 Pellino-1 |
| Ensembl ID | ENSP00000351789 |
| Symbol | PRISM |
| Family | Belongs to the pellino family. |
| Sequence | MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746407 | PELI1 | pellino E3 ubiquitin protein ligase 1 | 9598 | VGNC:333 | OMA, EggNOG |
| Mouse | 67245 | Peli1 | pellino 1 | 10090 | MGI:1914495 | Inparanoid, OMA, EggNOG |
| Rat | 305549 | Peli1 | pellino E3 ubiquitin protein ligase 1 | 10116 | RGD:1311199 | Inparanoid, OMA |
| Dog | 481388 | PELI1 | pellino E3 ubiquitin protein ligase 1 | 9615 | VGNC:44414 | Inparanoid, OMA |
| Horse | 100051401 | PELI1 | pellino E3 ubiquitin protein ligase 1 | 9796 | VGNC:21305 | Inparanoid, OMA |
| Cow | 535054 | PELI1 | pellino E3 ubiquitin protein ligase 1 | 9913 | VGNC:32740 | Inparanoid, OMA |
| Platypus | 100078304 | PELI1 | pellino E3 ubiquitin protein ligase 1 | 9258 | Inparanoid, OMA | |
| Chicken | 421279 | PELI1 | pellino E3 ubiquitin protein ligase 1 | 9031 | CGNC:51458 | Inparanoid, OMA |
| Anole lizard | 100553038 | peli1 | pellino E3 ubiquitin protein ligase 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 100125008 | peli2 | pellino E3 ubiquitin protein ligase family member 2 | 8364 | XB-GENE-992979 | Inparanoid, OMA |
| Zebrafish | 558420 | peli1b | pellino E3 ubiquitin protein ligase 1b | 7955 | ZDB-GENE-061027-372 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.