🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RAC2

DescripciónRas-related C3 botulinum toxin substrate 2

Gene and Protein Information

Gene ID5880
Uniprot Accession IDs P15153 Q9UDJ4
Ensembl ID ENSP00000249071
Symbol Gx EN-7 HSPC022 p21-Rac2
FamilyBelongs to the small GTPase superfamily. Rho family.
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse19354Rac2Rac family small GTPase 210090MGI:97846Inparanoid, OMA
Rat366957Rac2Rac family small GTPase 210116RGD:1307568Inparanoid, OMA
Dog481271RAC2Rac family small GTPase 29615VGNC:49610Inparanoid, OMA
Horse100054701RAC2Rac family small GTPase 29796VGNC:49130Inparanoid, OMA
Cow327671RAC2Rac family small GTPase 29913VGNC:49061Inparanoid, OMA
OpossumRAC2Rac family small GTPase 2 [Source:HGNC Symbol;Acc:HGNC:9802]13616Inparanoid, OMA
Platypus100092844RAC2Rac family small GTPase 29258Inparanoid, OMA
Chicken418044RAC2ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)9031CGNC:9462Inparanoid, OMA
Anole lizard100557692rac2Rac family small GTPase 228377Inparanoid, OMA
Zebrafish415151rac2Rac family small GTPase 27955ZDB-GENE-040625-27Inparanoid, OMA
C. elegans186939rac-2Ras-related protein rac-26239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    small GTPase    /    Ras-related C3 botulinum toxin substrate 2
DTO Classes
protein    /    Enzyme modulator    /    G-protein    /    Small GTPase    /    Ras-related C3 botulinum toxin substrate 2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.