RBBP7

DescripciónHistone-binding protein RBBP7

Gene and Protein Information

Gene ID5931
Uniprot Accession IDs Q16576 Q5JP00
Ensembl ID ENSP00000369424
Symbol RBAP46 RbAp46
FamilyBelongs to the WD repeat RBAP46/RBAP48/MSI1 family.
Sequence
MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp465518RBBP7RB binding protein 7, chromatin remodeling factor9598VGNC:1203Inparanoid, OMA, EggNOG
Macaque713843RBBP7RB binding protein 7, chromatin remodeling factor9544Inparanoid, OMA
Mouse245688Rbbp7retinoblastoma binding protein 7, chromatin remodeling factor10090MGI:1194910Inparanoid, OMA
Rat83712Rbbp7RB binding protein 7, chromatin remodeling factor10116RGD:620125Inparanoid, OMA
Dog480854RBBP7RB binding protein 7, chromatin remodeling factor9615VGNC:45393Inparanoid, OMA
Horse100056761RBBP7RB binding protein 7, chromatin remodeling factor9796VGNC:22221Inparanoid, OMA
Cow537402RBBP7RB binding protein 7, chromatin remodeling factor9913VGNC:33772Inparanoid, OMA
Opossum100016649RBBP7RB binding protein 7, chromatin remodeling factor13616Inparanoid, OMA
Platypus100085544RBBP7RB binding protein 7, chromatin remodeling factor9258Inparanoid, OMA
Chicken395390RBBP7RB binding protein 7, chromatin remodeling factor9031CGNC:12390Inparanoid, OMA
Xenopus394900rbbp7retinoblastoma binding protein 78364XB-GENE-487909Inparanoid, OMA, EggNOG
C. elegans172802lin-53Probable histone-binding protein lin-536239Inparanoid, OMA
S.cerevisiae856654HAT2Hat2p4932S000000782Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.