Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Quinone oxidoreductase |
|---|
Gene and Protein Information
| Gene ID | 1429 |
|---|---|
| Uniprot Accession IDs | Q08257 A6NN60 D3DQ76 Q53FT0 Q59EU7 Q5HYE7 Q6NSK9 |
| Ensembl ID | ENSP00000399805 |
| Family | Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. |
| Sequence | MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456952 | CRYZ | crystallin zeta | 9598 | VGNC:10592 | OMA, EggNOG |
| Macaque | CRYZ | glutamate rich 3 [Source:HGNC Symbol;Acc:HGNC:25346] | 9544 | Inparanoid, EggNOG | ||
| Mouse | 12972 | Cryz | crystallin, zeta | 10090 | MGI:88527 | Inparanoid, OMA, EggNOG |
| Rat | 362061 | Cryz | crystallin zeta | 10116 | RGD:1311639 | Inparanoid, OMA, EggNOG |
| Dog | 611431 | CRYZ | crystallin zeta | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100053415 | CRYZ | crystallin zeta | 9796 | VGNC:16889 | Inparanoid, OMA, EggNOG |
| Cow | 281093 | CRYZ | crystallin zeta | 9913 | VGNC:27746 | Inparanoid, OMA, EggNOG |
| Pig | 733653 | CRYZ | crystallin zeta | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | CRYZ | crystallin zeta [Source:HGNC Symbol;Acc:HGNC:2419] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | 100074501 | CRYZ | crystallin zeta | 9258 | OMA, EggNOG | |
| Chicken | 772289 | CRYZ | crystallin zeta | 9031 | CGNC:8638 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100565320 | LOC100565320 | quinone oxidoreductase | 28377 | OMA, EggNOG | |
| Xenopus | 448193 | cryz | crystallin zeta | 8364 | XB-GENE-966820 | Inparanoid, OMA, EggNOG |
| Zebrafish | 407640 | cryz | crystallin, zeta (quinone reductase) | 7955 | ZDB-GENE-050306-24 | Inparanoid, OMA, EggNOG |
| C. elegans | 173346 | F39B2.3 | hypothetical protein | 6239 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.