224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Retinoic acid receptor beta |
|---|
Gene and Protein Information
| Gene ID | 5915 |
|---|---|
| Uniprot Accession IDs | P10826 P12891 Q00989 Q15298 Q9UN48 RAR-beta |
| Ensembl ID | ENSP00000332296 |
| Symbol | HAP NR1B2 HAP RRB2 NR1B2 MCOPS12 RARbeta1 |
| Family | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
| Sequence | MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745516 | RARB | retinoic acid receptor beta | 9598 | VGNC:7111 | OMA, EggNOG |
| Macaque | 700485 | RARB | retinoic acid receptor beta | 9544 | OMA, EggNOG | |
| Mouse | 218772 | Rarb | retinoic acid receptor, beta | 10090 | MGI:97857 | Inparanoid, OMA |
| Rat | 24706 | Rarb | retinoic acid receptor, beta | 10116 | RGD:3535 | Inparanoid, OMA |
| Dog | 477045 | RARB | retinoic acid receptor beta | 9615 | VGNC:45352 | Inparanoid, OMA, EggNOG |
| Horse | 100051546 | RARB | retinoic acid receptor beta | 9796 | VGNC:22185 | Inparanoid, OMA, EggNOG |
| Opossum | 100024675 | RARB | retinoic acid receptor beta | 13616 | Inparanoid, OMA | |
| Platypus | RARB | retinoic acid receptor beta [Source:HGNC Symbol;Acc:HGNC:9865] | 9258 | OMA, EggNOG | ||
| Chicken | 396266 | RARB | retinoic acid receptor beta | 9031 | CGNC:8589 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562902 | rarb | retinoic acid receptor beta | 28377 | Inparanoid, OMA | |
| Xenopus | 100488600 | rarb | retinoic acid receptor beta | 8364 | XB-GENE-481009 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.