224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Ras-related protein Rab-7b |
|---|
Gene and Protein Information
| Gene ID | 338382 |
|---|---|
| Uniprot Accession IDs | Q96AH8 |
| Ensembl ID | ENSP00000479762 |
| Symbol | RAB7 |
| Family | Belongs to the small GTPase superfamily. Rab family. |
| Sequence | MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 226421 | Rab7b | RAB7B, member RAS oncogene family | 10090 | MGI:2442295 | Inparanoid, OMA |
| Rat | 501854 | Rab7b | Rab7b, member RAS oncogene family | 10116 | RGD:1562617 | Inparanoid, OMA |
| Cow | 538050 | RAB7B | RAB7B, member RAS oncogene family | 9913 | VGNC:33661 | Inparanoid, OMA |
| Xenopus | 100124979 | rab7b | RAB7B, member RAS oncogene family | 8364 | XB-GENE-5824213 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.