🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RBBP4

DescripciónHistone-binding protein RBBP4

Gene and Protein Information

Gene ID5928
Uniprot Accession IDs Q09028 B2R6G9 B4DRH0 D3DPQ3 P31149 Q53H02 Q96BV9
Ensembl ID ENSP00000362592
Symbol RBAP48 NURF55 RBAP48 lin-53
FamilyBelongs to the WD repeat RBAP46/RBAP48/MSI1 family.
Sequence
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque708710RBBP4RB binding protein 4, chromatin remodeling factor9544Inparanoid, OMA
Mouse19646Rbbp4retinoblastoma binding protein 4, chromatin remodeling factor10090MGI:1194912Inparanoid, OMA
Rat313048Rbbp4RB binding protein 4, chromatin remodeling factor10116RGD:1593768Inparanoid, OMA
Dog478149RBBP4RB binding protein 4, chromatin remodeling factor9615VGNC:45391Inparanoid, OMA
Horse100070175RBBP4RB binding protein 4, chromatin remodeling factor9796VGNC:22220Inparanoid, OMA
Cow767940RBBP4RB binding protein 4, chromatin remodeling factor9913VGNC:33770Inparanoid, OMA
Opossum100025905RBBP4RB binding protein 4, chromatin remodeling factor13616Inparanoid, OMA
Chicken395658RBBP4RB binding protein 4, chromatin remodeling factor9031CGNC:2572Inparanoid, OMA
Anole lizard100561534rbbp4RB binding protein 4, chromatin remodeling factor28377Inparanoid, OMA
Xenopus496866rbbp4retinoblastoma binding protein 48364XB-GENE-482002Inparanoid, OMA
Zebrafish321726rbbp4retinoblastoma binding protein 47955ZDB-GENE-030131-445Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.