🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PLSCR3

DescripciónPhospholipid scramblase 3

Gene and Protein Information

Gene ID57048
Uniprot Accession IDs Q9NRY6 A8K252 Q567U0 Q8NBW6 Q96F13 PL scramblase 3
Ensembl ID ENSP00000438547
FamilyBelongs to the phospholipid scramblase family.
Sequence
MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAVTS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp750610PLSCR3phospholipid scramblase 39598VGNC:51726OMA, EggNOG
Macaque721831PLSCR3phospholipid scramblase 39544Inparanoid, OMA
Mouse70310Plscr3phospholipid scramblase 310090MGI:1917560Inparanoid, OMA, EggNOG
Rat360549Plscr3phospholipid scramblase 310116RGD:1307016Inparanoid, OMA, EggNOG
Dog489471PLSCR3phospholipid scramblase 39615Inparanoid, OMA, EggNOG
Horse100072978PLSCR3phospholipid scramblase 39796Inparanoid, OMA, EggNOG
Cow510355PLSCR3phospholipid scramblase 39913Inparanoid, OMA, EggNOG
Pig102163020PLSCR3phospholipid scramblase 39823OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.