224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Gap junction beta-6 protein |
|---|
Gene and Protein Information
| Gene ID | 10804 |
|---|---|
| Uniprot Accession IDs | O95452 B3KQN2 Q5Q1H9 Q5Q1I0 Q5Q1I1 Q5T5U0 Q8IUP0 |
| Ensembl ID | ENSP00000348521 |
| Symbol | ED2 EDH HED CX30 HED2 DFNA3 ECTD2 DFNA3B DFNB1B |
| Family | Belongs to the connexin family. Beta-type (group I) subfamily. |
| Sequence | MDWGTLHTFIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGCKNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETTRKFRRGEKRNDFKDIEDIKKQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDCFISRPTEKTVFTIFMISASVICMLLNVAELCYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFPS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 750343 | GJB6 | gap junction protein beta 6 | 9598 | VGNC:5062 | OMA, EggNOG |
| Macaque | 704105 | GJB6 | gap junction protein beta 6 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14623 | Gjb6 | gap junction protein, beta 6 | 10090 | MGI:107588 | Inparanoid, OMA, EggNOG |
| Rat | 84403 | Gjb6 | gap junction protein, beta 6 | 10116 | RGD:621830 | Inparanoid, OMA, EggNOG |
| Dog | 100688824 | GJB6 | gap junction protein beta 6 | 9615 | VGNC:41242 | Inparanoid, OMA, EggNOG |
| Horse | 100053788 | GJB6 | gap junction protein beta 6 | 9796 | VGNC:18359 | Inparanoid, OMA, EggNOG |
| Cow | 508454 | GJB6 | gap junction protein beta 6 | 9913 | VGNC:29381 | Inparanoid, OMA, EggNOG |
| Opossum | 100619471 | GJB6 | gap junction protein beta 6 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100089296 | GJB6 | gap junction protein beta 6 | 9258 | Inparanoid, OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.