🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RALA

DescripciónRas-related protein Ral-A

Gene and Protein Information

Gene ID5898
Uniprot Accession IDs P11233 A4D1W3
Ensembl ID ENSP00000005257
Symbol RAL RAL
FamilyBelongs to the small GTPase superfamily. Ras family.
Sequence
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp737424RALARAS like proto-oncogene A9598VGNC:10412OMA, EggNOG
Mouse56044Ralav-ral simian leukemia viral oncogene A (ras related)10090MGI:1927243Inparanoid, OMA, EggNOG
Rat81757RalaRAS like proto-oncogene A10116RGD:619851Inparanoid, OMA
Dog475875RALARAS like proto-oncogene A9615VGNC:45330Inparanoid, OMA, EggNOG
Horse100051360RALARAS like proto-oncogene A9796VGNC:22159Inparanoid, OMA, EggNOG
Cow538477RALARAS like proto-oncogene A9913VGNC:33698Inparanoid, OMA, EggNOG
Pig100622254RALARAS like proto-oncogene A9823OMA, EggNOG
Opossum100011023RALARAS like proto-oncogene A13616Inparanoid, OMA, EggNOG
Anole lizard100555475ralaRAS like proto-oncogene A28377Inparanoid, OMA, EggNOG
Xenopus548669ralav-ral simian leukemia viral oncogene homolog A (ras related)8364XB-GENE-485016Inparanoid, OMA, EggNOG
Zebrafish393993ralaav-ral simian leukemia viral oncogene homolog Aa (ras related)7955ZDB-GENE-040426-1344Inparanoid, OMA, EggNOG
C. elegans175433ral-1RAL (Ras-related GTPase) homolog6239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    small GTPase    /    Ras-related protein Ral-A
DTO Classes
protein    /    Enzyme modulator    /    G-protein    /    Small GTPase    /    Ras-related protein Ral-A

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.