🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PCNA

DescripciónProliferating cell nuclear antigen

Gene and Protein Information

Gene ID5111
Uniprot Accession IDs P12004 B2R897 D3DW02 PCNA
Ensembl ID ENSP00000368458
Symbol ATLD2
FamilyBelongs to the PCNA family.
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp458081PCNAproliferating cell nuclear antigen9598VGNC:6229OMA, EggNOG
Macaque718006PCNAproliferating cell nuclear antigen9544Inparanoid, OMA, EggNOG
Mouse18538Pcnaproliferating cell nuclear antigen10090MGI:97503OMA, EggNOG
Mouse18540Pcna-ps2proliferating cell nuclear antigen pseudogene 210090MGI:97505Inparanoid, OMA
Rat25737Pcnaproliferating cell nuclear antigen10116RGD:3269Inparanoid, OMA, EggNOG
Dog477166PCNAproliferating cell nuclear antigen9615VGNC:44310Inparanoid, OMA, EggNOG
Horse100052065PCNAproliferating cell nuclear antigen9796VGNC:21207Inparanoid, OMA, EggNOG
Cow515499PCNAproliferating cell nuclear antigen9913VGNC:32635Inparanoid, OMA, EggNOG
Pig692192PCNAproliferating cell nuclear antigen9823Inparanoid, OMA, EggNOG
Opossum100029293PCNAproliferating cell nuclear antigen13616Inparanoid, EggNOG
Anole lizard100560949pcnaproliferating cell nuclear antigen28377Inparanoid, OMA, EggNOG
Xenopus493302pcnaproliferating cell nuclear antigen8364XB-GENE-972522Inparanoid, OMA, EggNOG
Zebrafish30678pcnaproliferating cell nuclear antigen7955ZDB-GENE-000210-8Inparanoid, OMA, EggNOG
C. elegans177161pcn-1Proliferating cell nuclear antigen6239Inparanoid, OMA
Fruitfly37290PCNAProliferating cell nuclear antigen7227FBgn0005655Inparanoid, OMA, EggNOG
S.cerevisiae852385POL30proliferating cell nuclear antigen4932S000000292Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA polymerase processivity factor    /    Proliferating cell nuclear antigen
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    DNA polymerase processivity factor    /    Proliferating cell nuclear antigen

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.