The store will not work correctly when cookies are disabled.
Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
NDUFA4 Descripción Cytochrome c oxidase subunit NDUFA4
Gene and Protein Information Gene ID 4697 Uniprot Accession IDs O00483 A4D109 Q6FHN5 Ensembl ID ENSP00000339720 Symbol MLRQ CI-9k COXFA4 CI-MLRQ Family Belongs to the complex IV NDUFA4 subunit family. Sequence MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
Homologous gene and protein info.
Species Gene ID Gene Symbol Nombre NIF Other Gene ID Sources Mouse 17992 Ndufa4 Ndufa4, mitochondrial complex associated 10090 MGI:107686 Inparanoid, OMA, EggNOG Rat 681024 Ndufa4 NDUFA4, mitochondrial complex associated 10116 RGD:1584719 Inparanoid, OMA, EggNOG Horse NDUFA4 NDUFA4, mitochondrial complex associated [Source:HGNC Symbol;Acc:HGNC:7687] 9796 OMA, EggNOG Cow 327704 NDUFA4 NDUFA4, mitochondrial complex associated 9913 VGNC:31947 Inparanoid, OMA, EggNOG Pig 100579141 NDUFA4 NDUFA4, mitochondrial complex associated 9823 OMA, EggNOG Opossum 100025610 NDUFA4 NDUFA4, mitochondrial complex associated 13616 Inparanoid, OMA, EggNOG Chicken 772135 NDUFA4 NDUFA4, mitochondrial complex associated 9031 CGNC:66679 Inparanoid, OMA Zebrafish 406298 ndufa4 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 7955 ZDB-GENE-040426-1962 Inparanoid, OMA, EggNOG
Associated Recombinant Proteins Nombre Specification and purity Expression system Protein label Disponibilidad Mostrar detalles
Associated Antibodies
Nombre Specifications Species reactivity Aplicación Disponibilidad Mostrar detalles
Associated Approved Drugs Associated Active Ligands Associated Diseases Nombre Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Configuración Aceptar todo Rechazar
Shall we send you a message when we have discounts available?
Remind me later Permitir
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.