🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

NDUFB11

DescripciónNADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial

Gene and Protein Information

Gene ID54539
Uniprot Accession IDs Q9NX14 Q5JRR3 Q5JRR4 Q6IAB6 Q8WZ96 Q9BXX9
Ensembl ID ENSP00000276062
Symbol ESSS Np15 P17.3 NP17.3 CI-ESSS MC1DN30
FamilyBelongs to the complex I NDUFB11 subunit family.
Sequence
MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp473588NDUFB11NADH:ubiquinone oxidoreductase subunit B119598VGNC:14736Inparanoid, OMA, EggNOG
Mouse104130Ndufb11NADH:ubiquinone oxidoreductase subunit B1110090MGI:1349919Inparanoid, OMA
Rat299310Ndufb11NADH:ubiquinone oxidoreductase subunit B1110116RGD:1563698Inparanoid, OMA, EggNOG
Dog480894NDUFB11NADH:ubiquinone oxidoreductase subunit B119615VGNC:43700Inparanoid, OMA, EggNOG
Horse100060719NDUFB11NADH:ubiquinone oxidoreductase subunit B119796VGNC:20637Inparanoid, OMA, EggNOG
Cow404161NDUFB11NADH:ubiquinone oxidoreductase subunit B119913VGNC:31961Inparanoid, OMA, EggNOG
Opossum100618050NDUFB11NADH:ubiquinone oxidoreductase subunit B1113616Inparanoid, OMA, EggNOG
Zebrafish562219ndufb11NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 117955ZDB-GENE-050309-25Inparanoid, EggNOG
Fruitfly42282NP15.6CG6008 gene product from transcript CG6008-RA7227FBgn0027785Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.