224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Neuromedin-K receptor |
|---|
Gene and Protein Information
| Gene ID | 6870 |
|---|---|
| Uniprot Accession IDs | P29371 Q0P510 NKR |
| Ensembl ID | ENSP00000303325 |
| Symbol | NK3R TAC3R NK3 NKR HH11 NK3R NK-3R TAC3R TAC3RL |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADTTRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461414 | TACR3 | tachykinin receptor 3 | 9598 | VGNC:12848 | OMA, EggNOG |
| Mouse | 21338 | Tacr3 | tachykinin receptor 3 | 10090 | MGI:892968 | Inparanoid, OMA, EggNOG |
| Rat | 24808 | Tacr3 | tachykinin receptor 3 | 10116 | RGD:3810 | Inparanoid, OMA, EggNOG |
| Dog | 403814 | TACR3 | tachykinin receptor 3 | 9615 | VGNC:47068 | Inparanoid, OMA, EggNOG |
| Horse | 100073088 | TACR3 | tachykinin receptor 3 | 9796 | VGNC:23843 | Inparanoid, OMA, EggNOG |
| Cow | 404136 | TACR3 | tachykinin receptor 3 | 9913 | VGNC:35562 | Inparanoid, OMA, EggNOG |
| Pig | 100521983 | TACR3 | tachykinin receptor 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100013731 | TACR3 | tachykinin receptor 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 768993 | TACR3 | tachykinin receptor 3 | 9031 | CGNC:8046 | Inparanoid, OMA, EggNOG |
| Zebrafish | 559201 | tacr3l | tachykinin receptor 3-like | 7955 | ZDB-GENE-061207-19 | OMA, EggNOG |
| C. elegans | 183595 | tkr-2 | TachyKinin Receptor family | 6239 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Tachykinin receptor / Neuromedin-K receptor
protein / G-protein coupled receptor / Class A rhodopsin like / Tachykinin receptor / Neuromedin-K receptor
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.