Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Rho-related GTP-binding protein RhoQ |
|---|
Gene and Protein Information
| Gene ID | 23433 |
|---|---|
| Uniprot Accession IDs | P17081 D6W5A6 Q0VGN1 Q52LS8 Q53SJ1 Q6NS39 Q6P146 Q7Z480 |
| Ensembl ID | ENSP00000238738 |
| Symbol | ARHQ RASL7A TC10 ARHQ TC10 TC10A RASL7A HEL-S-42 |
| Family | Belongs to the small GTPase superfamily. Rho family. |
| Sequence | MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 717769 | RHOQ | ras homolog family member Q | 9544 | OMA, EggNOG | |
| Mouse | 104215 | Rhoq | ras homolog family member Q | 10090 | MGI:1931553 | Inparanoid, OMA, EggNOG |
| Rat | 85428 | Rhoq | ras homolog family member Q | 10116 | RGD:621626 | Inparanoid, OMA |
| Dog | 474579 | RHOQ | ras homolog family member Q | 9615 | VGNC:54538 | OMA, EggNOG |
| Horse | 100068479 | RHOQ | ras homolog family member Q | 9796 | VGNC:51398 | Inparanoid, OMA, EggNOG |
| Cow | 100139988 | RHOQ | ras homolog family member Q | 9913 | VGNC:33952 | Inparanoid, OMA, EggNOG |
| Opossum | 100032199 | RHOQ | ras homolog family member Q | 13616 | Inparanoid, EggNOG | |
| Chicken | 395114 | RHOQ | ras homolog family member Q | 9031 | CGNC:49176 | Inparanoid, OMA |
| Anole lizard | 100567122 | rhoq | ras homolog family member Q | 28377 | Inparanoid, OMA | |
| Zebrafish | 327510 | rhoq | ras homolog family member Q | 7955 | ZDB-GENE-030131-5721 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Rho-related GTP-binding protein RhoQ
protein / Enzyme modulator / G-protein / Small GTPase / Rho-related GTP-binding protein RhoQ
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.