🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RGS17

DescripciónRegulator of G-protein signaling 17

Gene and Protein Information

Gene ID26575
Uniprot Accession IDs Q9UGC6 Q5TF49 Q8TD61 Q9UJS8 RGS17
Ensembl ID ENSP00000356194
Symbol RGSZ2 RGSZ2 RGS-17 hRGS17
Sequence
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp737204RGS17regulator of G protein signaling 179598VGNC:11204OMA, EggNOG
Macaque100429275RGS17regulator of G protein signaling 179544OMA, EggNOG
Mouse56533Rgs17regulator of G-protein signaling 1710090MGI:1927469Inparanoid, OMA, EggNOG
Rat308118Rgs17regulator of G-protein signaling 1710116RGD:1305515Inparanoid, OMA, EggNOG
Dog608867RGS17regulator of G protein signaling 179615VGNC:45526Inparanoid, OMA, EggNOG
Horse100060098RGS17regulator of G protein signaling 179796VGNC:22345Inparanoid, OMA, EggNOG
Cow504255RGS17regulator of G protein signaling 179913VGNC:33916Inparanoid, OMA, EggNOG
Pig100514020RGS17regulator of G protein signaling 179823OMA, EggNOG
Opossum100027291RGS17regulator of G protein signaling 1713616Inparanoid, OMA, EggNOG
PlatypusRGS17regulator of G protein signaling 17 [Source:HGNC Symbol;Acc:HGNC:14088]9258OMA, EggNOG
Chicken395645RGS17regulator of G-protein signaling 179031CGNC:66208Inparanoid, OMA
Anole lizard100558841rgs17regulator of G protein signaling 1728377Inparanoid, OMA, EggNOG
Xenopusrgs17regulator of G-protein signaling 17 [Source:Xenbase;Acc:XB-GENE-984104]8364OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    G-protein modulator    /    Regulator of G-protein signaling 17
DTO Classes
protein    /    Enzyme modulator    /    G-protein modulator    /    Regulator of G-protein signaling 17

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.