RGS4

DescripciónRegulator of G-protein signaling 4

Gene and Protein Information

Gene ID5999
Uniprot Accession IDs P49798 A7XA56 A7XA58 A7XA59 A7YVV7 B1APZ3 RGP4
Ensembl ID ENSP00000397181
Symbol RGP4 SCZD9
Sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp457470RGS4regulator of G protein signaling 49598VGNC:8097OMA, EggNOG
Macaque693383RGS4regulator of G protein signaling 49544Inparanoid, OMA, EggNOG
Mouse19736Rgs4regulator of G-protein signaling 410090MGI:108409Inparanoid, OMA, EggNOG
Rat29480Rgs4regulator of G-protein signaling 410116RGD:3567Inparanoid, OMA, EggNOG
Dog488666RGS4regulator of G protein signaling 49615VGNC:45534Inparanoid, OMA, EggNOG
Horse100058342RGS4regulator of G protein signaling 49796VGNC:22353Inparanoid, OMA, EggNOG
Cow617437RGS4regulator of G protein signaling 49913VGNC:54394Inparanoid, OMA, EggNOG
Pig100157437RGS4regulator of G protein signaling 49823Inparanoid, OMA, EggNOG
Opossum100012570RGS4regulator of G protein signaling 413616Inparanoid, OMA, EggNOG
Chicken378901RGS4regulator of G-protein signaling 49031CGNC:49134Inparanoid, OMA, EggNOG
Xenopus394913rgs4regulator of G-protein signaling 48364XB-GENE-942771Inparanoid, OMA, EggNOG
Zebrafish569876rgs4regulator of G protein signaling 47955ZDB-GENE-030131-9839Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    G-protein modulator    /    Regulator of G-protein signaling 4
DTO Classes
protein    /    Enzyme modulator    /    G-protein modulator    /    Regulator of G-protein signaling 4

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.