🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RASD2

DescripciónGTP-binding protein Rhes

Gene and Protein Information

Gene ID23551
Uniprot Accession IDs Q96D21 O95520 Q5THY8
Ensembl ID ENSP00000216127
Symbol TEM2 Rhes TEM2
FamilyBelongs to the small GTPase superfamily. RasD family.
Sequence
MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp470196RASD2RASD family member 29598VGNC:6018OMA, EggNOG
Mouse75141Rasd2RASD family, member 210090MGI:1922391Inparanoid, OMA, EggNOG
Rat171099Rasd2RASD family, member 210116RGD:628594Inparanoid, OMA, EggNOG
Dog481284RASD2RASD family member 29615VGNC:45365Inparanoid, OMA, EggNOG
Horse100054386RASD2RASD family member 29796VGNC:22194Inparanoid, OMA, EggNOG
Cow527921RASD2RASD family member 29913VGNC:33741Inparanoid, OMA, EggNOG
Opossum100016530RASD2RASD family member 213616Inparanoid, OMA, EggNOG
PlatypusRASD2RASD family member 2 [Source:HGNC Symbol;Acc:HGNC:18229]9258OMA, EggNOG
Chicken418057RASD2RASD family member 29031CGNC:9520Inparanoid, OMA
Anole lizard100559661rasd2RASD family member 228377Inparanoid, OMA
Xenopus548760rasd2RASD family member 28364XB-GENE-494969Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.