NIFK

DescripciónMKI67 FHA domain-interacting nucleolar phosphoprotein

Gene and Protein Information

Gene ID84365
Uniprot Accession IDs Q9BYG3 A8K788 Q8TB66 Q96ED4
Ensembl ID ENSP00000285814
Symbol MKI67IP NOPP34 Nopp34 MKI67IP
Sequence
MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp459585NIFKnucleolar protein interacting with the FHA domain of MKI679598VGNC:2712OMA, EggNOG
Macaque697198NIFKnucleolar protein interacting with the FHA domain of MKI679544OMA, EggNOG
Mouse67949Nifknucleolar protein interacting with the FHA domain of MKI6710090MGI:1915199Inparanoid, OMA, EggNOG
Rat246042Nifknucleolar protein interacting with the FHA domain of MKI6710116RGD:708462Inparanoid, OMA, EggNOG
Dog100856252NIFKnucleolar protein interacting with the FHA domain of MKI679615VGNC:43809OMA, EggNOG
Horse100055172NIFKnucleolar protein interacting with the FHA domain of MKI679796VGNC:51485OMA, EggNOG
Cow509598NIFKnucleolar protein interacting with the FHA domain of MKI679913VGNC:32076Inparanoid, OMA, EggNOG
Pig100124386NIFKnucleolar protein interacting with the FHA domain of MKI679823OMA, EggNOG
Opossum100011091NIFKnucleolar protein interacting with the FHA domain of MKI6713616OMA, EggNOG
Chicken424239NIFKnucleolar protein interacting with the FHA domain of MKI679031CGNC:8852OMA, EggNOG
Anole lizard100564113nifknucleolar protein interacting with the FHA domain of MKI6728377OMA, EggNOG
Zebrafish317644nifknucleolar protein interacting with the FHA domain of MKI677955ZDB-GENE-021231-4Inparanoid, OMA, EggNOG
Fruitfly42662CG6937CG6937 gene product from transcript CG6937-RA7227FBgn0038989Inparanoid, EggNOG
S.cerevisiae855613NOP15rRNA-binding ribosome biosynthesis protein NOP154932S000005054Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.