🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PRKCZ

DescripciónProtein kinase C zeta type

Gene and Protein Information

Gene ID5590
Uniprot Accession IDs Q05513 A8K4N0 A8MU64 B7Z2J7 E9PCW2 Q15207 Q5SYT5 Q969S4
Ensembl ID ENSP00000367830
Symbol PKC2 PKC2 PKC-ZETA
FamilyBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
Sequence
MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque100430236LOC100430236protein kinase C zeta type-like9544Inparanoid, OMA, EggNOG
Mouse18762Prkczprotein kinase C, zeta10090MGI:97602Inparanoid, OMA
Rat25522Prkczprotein kinase C, zeta10116RGD:3399Inparanoid, OMA
Dog479577PRKCZprotein kinase C zeta9615VGNC:44985Inparanoid, OMA
Horse100064240PRKCZprotein kinase C zeta9796VGNC:21850Inparanoid, OMA
Cow286877PRKCZprotein kinase C zeta9913VGNC:33336Inparanoid, OMA
Chicken419399PRKCZprotein kinase C zeta9031CGNC:866Inparanoid, OMA
Xenopus100101769prkczprotein kinase C zeta8364XB-GENE-494709Inparanoid, OMA
Zebrafish555737prkczprotein kinase C, zeta7955ZDB-GENE-070511-1Inparanoid, OMA
C. elegans173914pkc-3Protein kinase C-like 36239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    non-receptor serine/threonine protein kinase    /    Protein kinase c zeta type
protein    /    calcium-binding protein    /    transfer/carrier protein    /    Protein kinase c zeta type
protein    /    calcium-binding protein    /    protein kinase    /    Protein kinase c zeta type
protein    /    calcium-binding protein    /    calmodulin    /    Protein kinase c zeta type
protein    /    calcium-binding protein    /    annexin    /    Protein kinase c zeta type
protein    /    calcium-binding protein    /    transferase    /    Protein kinase c zeta type
protein    /    calcium-binding protein    /    kinase    /    Protein kinase c zeta type
DTO Classes
protein    /    Kinase    /    Protein kinase    /    AGC group    /    PKC family    /    PKC iota subfamily    /    Protein kinase c zeta type

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.