224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Matrilysin |
|---|
Gene and Protein Information
| Gene ID | 4316 |
|---|---|
| Uniprot Accession IDs | P09237 Q9BTK9 |
| Ensembl ID | ENSP00000260227 |
| Symbol | MPSL1 PUMP1 MMP-7 MPSL1 PUMP-1 |
| Family | Belongs to the peptidase M10A family. |
| Sequence | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451509 | MMP7 | matrix metallopeptidase 7 | 9598 | VGNC:1103 | OMA, EggNOG |
| Macaque | 703072 | MMP7 | matrix metallopeptidase 7 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 17393 | Mmp7 | matrix metallopeptidase 7 | 10090 | MGI:103189 | Inparanoid, OMA, EggNOG |
| Rat | 25335 | Mmp7 | matrix metallopeptidase 7 | 10116 | RGD:3100 | Inparanoid, OMA, EggNOG |
| Dog | 489432 | MMP7 | matrix metallopeptidase 7 | 9615 | VGNC:43288 | Inparanoid, OMA, EggNOG |
| Horse | 100068985 | MMP7 | matrix metallopeptidase 7 | 9796 | VGNC:20235 | Inparanoid, OMA, EggNOG |
| Cow | 286794 | MMP7 | matrix metallopeptidase 7 | 9913 | VGNC:31529 | Inparanoid, OMA, EggNOG |
| Pig | 397411 | MMP7 | matrix metallopeptidase 7 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100012296 | MMP7 | matrix metallopeptidase 7 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100079035 | LOC100079035 | matrilysin | 9258 | OMA, EggNOG | |
| Chicken | 418983 | MMP7 | matrix metallopeptidase 7 | 9031 | CGNC:50889 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100553835 | LOC100553835 | matrilysin | 28377 | Inparanoid, OMA | |
| Anole lizard | 100553635 | LOC100553635 | macrophage metalloelastase | 28377 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.