224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Kallikrein-7 |
|---|
Gene and Protein Information
| Gene ID | 5650 |
|---|---|
| Uniprot Accession IDs | P49862 A8K0U5 Q8N5N9 Q8NFV7 hK7 |
| Ensembl ID | ENSP00000375683 |
| Symbol | PRSS6 SCCE hK7 SCCE PRSS6 |
| Family | Belongs to the peptidase S1 family. Kallikrein subfamily. |
| Sequence | MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 722683 | KLK7 | kallikrein related peptidase 7 | 9544 | OMA, EggNOG | |
| Mouse | 23993 | Klk7 | kallikrein related-peptidase 7 (chymotryptic, stratum corneum) | 10090 | MGI:1346336 | Inparanoid, OMA, EggNOG |
| Cow | 506380 | KLK7 | kallikrein related peptidase 7 | 9913 | VGNC:30681 | Inparanoid, OMA, EggNOG |
| Opossum | 100012470 | LOC100012470 | kallikrein-7 | 13616 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.