KLK1

DescripciónKallikrein-1

Gene and Protein Information

Gene ID3816
Uniprot Accession IDs P06870 Q66US9 Q86U61 Q8TCV8 Q9BS53 Q9NQU4 Q9UD19 Q9UMJ1
Ensembl ID ENSP00000301420
Symbol hK1 KLKR Klk6
FamilyBelongs to the peptidase S1 family. Kallikrein subfamily.
Sequence
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse16624Klk1b8kallikrein 1-related peptidase b810090MGI:892018Inparanoid, OMA
RatKlk1b3kallikrein 1-related peptidase B3 [Source:RGD Symbol;Acc:3175]10116Inparanoid, OMA
Cow493738KLK1kallikrein 19913Inparanoid, OMA
Pig431673KLK1kallikrein 19823Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.