224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Kallikrein-1 |
|---|
Gene and Protein Information
| Gene ID | 3816 |
|---|---|
| Uniprot Accession IDs | P06870 Q66US9 Q86U61 Q8TCV8 Q9BS53 Q9NQU4 Q9UD19 Q9UMJ1 |
| Ensembl ID | ENSP00000301420 |
| Symbol | hK1 KLKR Klk6 |
| Family | Belongs to the peptidase S1 family. Kallikrein subfamily. |
| Sequence | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 16624 | Klk1b8 | kallikrein 1-related peptidase b8 | 10090 | MGI:892018 | Inparanoid, OMA |
| Rat | Klk1b3 | kallikrein 1-related peptidase B3 [Source:RGD Symbol;Acc:3175] | 10116 | Inparanoid, OMA | ||
| Cow | 493738 | KLK1 | kallikrein 1 | 9913 | Inparanoid, OMA | |
| Pig | 431673 | KLK1 | kallikrein 1 | 9823 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.