🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

NEDD8

DescripciónNEDD8

Gene and Protein Information

Gene ID4738
Uniprot Accession IDs Q15843 Q3SXN8 Q6LES6
Ensembl ID ENSP00000250495
Symbol NEDD-8
FamilyBelongs to the ubiquitin family.
Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
MacaqueNEDD8magnesium dependent phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:28781]9544Inparanoid, OMA, EggNOG
Mouse18002Nedd8neural precursor cell expressed, developmentally down-regulated gene 810090MGI:97301Inparanoid, OMA, EggNOG
Rat25490Nedd8neural precursor cell expressed, developmentally down-regulated 810116RGD:3158Inparanoid, OMA, EggNOG
Dog480265NEDD8neural precursor cell expressed, developmentally down-regulated 89615Inparanoid, OMA, EggNOG
Horse100051307NEDD8neural precursor cell expressed, developmentally down-regulated 89796Inparanoid, OMA, EggNOG
Cow286796NEDD8neural precursor cell expressed, developmentally down-regulated 89913Inparanoid, OMA, EggNOG
Opossum103101483NEDD8neural precursor cell expressed, developmentally down-regulated 813616Inparanoid, EggNOG
Xenopus549727nedd8neural precursor cell expressed, developmentally down-regulated 88364XB-GENE-6067551Inparanoid, OMA, EggNOG
Zebrafish368667nedd8neural precursor cell expressed, developmentally down-regulated 87955ZDB-GENE-030616-588Inparanoid, OMA, EggNOG
C. elegans172910ned-8NEDD86239Inparanoid, OMA, EggNOG
Fruitfly35151Nedd8CG10679 gene product from transcript CG10679-RB7227FBgn0032725Inparanoid, EggNOG
S.cerevisiae851717RUB1NEDD8 family protein RUB14932S000002546OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    ribosomal protein    /    NEDD8
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    Ribosomal protein    /    NEDD8

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.