224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Mitotic spindle assembly checkpoint protein MAD2A |
|---|
Gene and Protein Information
| Gene ID | 4085 |
|---|---|
| Uniprot Accession IDs | Q13257 Q53F56 Q548X9 Q6IRW7 Q8IZX3 HsMAD2 |
| Ensembl ID | ENSP00000296509 |
| Symbol | MAD2 MAD2 HSMAD2 |
| Family | Belongs to the MAD2 family. |
| Sequence | MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461661 | MAD2L1 | mitotic arrest deficient 2 like 1 | 9598 | VGNC:48884 | OMA, EggNOG |
| Mouse | 56150 | Mad2l1 | MAD2 mitotic arrest deficient-like 1 | 10090 | MGI:1860374 | Inparanoid, OMA, EggNOG |
| Rat | 297176 | Mad2l1 | mitotic arrest deficient 2 like 1 | 10116 | RGD:1310889 | Inparanoid, OMA, EggNOG |
| Dog | 476070 | MAD2L1 | mitotic arrest deficient 2 like 1 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100072353 | MAD2L1 | mitotic arrest deficient 2 like 1 | 9796 | VGNC:19884 | Inparanoid, OMA, EggNOG |
| Cow | 337870 | MAD2L1 | MAD2 mitotic arrest deficient-like 1 (yeast) | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | 100018245 | MAD2L1 | mitotic arrest deficient 2 like 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100081525 | MAD2L1 | mitotic arrest deficient 2 like 1 | 9258 | OMA, EggNOG | |
| Chicken | 422675 | MAD2L1 | MAD2 mitotic arrest deficient-like 1 (yeast) | 9031 | CGNC:51801 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100566557 | mad2l1 | mitotic arrest deficient 2 like 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100125170 | mad2l1 | mitotic arrest deficient 2 like 1 | 8364 | XB-GENE-947153 | Inparanoid, OMA, EggNOG |
| Zebrafish | 550434 | mad2l1 | MAD2 mitotic arrest deficient-like 1 (yeast) | 7955 | ZDB-GENE-030515-3 | Inparanoid, OMA, EggNOG |
| C. elegans | 177046 | mdf-2 | MAD (yeast Mitosis arrest DeFicient) related | 6239 | Inparanoid, OMA | |
| Fruitfly | 38656 | mad2 | CG17498 gene product from transcript CG17498-RA | 7227 | FBgn0035640 | Inparanoid, EggNOG |
| S.cerevisiae | 853422 | MAD2 | spindle checkpoint protein MAD2 | 4932 | S000003567 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.