Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Monoglyceride lipase |
|---|
Gene and Protein Information
| Gene ID | 11343 |
|---|---|
| Uniprot Accession IDs | Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 MGL |
| Ensembl ID | ENSP00000265052 |
| Symbol | MGL HUK5 MAGL HU-K5 |
| Family | Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family. |
| Sequence | MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 739167 | MGLL | monoglyceride lipase | 9598 | VGNC:2047 | OMA, EggNOG |
| Macaque | 100429242 | MGLL | monoglyceride lipase | 9544 | OMA, EggNOG | |
| Mouse | 23945 | Mgll | monoglyceride lipase | 10090 | MGI:1346042 | Inparanoid, OMA, EggNOG |
| Rat | 29254 | Mgll | monoglyceride lipase | 10116 | RGD:71039 | Inparanoid, OMA, EggNOG |
| Dog | 476511 | MGLL | monoglyceride lipase | 9615 | VGNC:54327 | Inparanoid, OMA, EggNOG |
| Horse | 100053785 | MGLL | monoglyceride lipase | 9796 | VGNC:20161 | Inparanoid, OMA, EggNOG |
| Cow | 505290 | MGLL | monoglyceride lipase | 9913 | VGNC:54454 | Inparanoid, OMA, EggNOG |
| Pig | 100233193 | MGLL | monoglyceride lipase | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100027819 | MGLL | monoglyceride lipase | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100559580 | mgll | monoglyceride lipase | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100127203 | mgll | monoglyceride lipase | 8364 | XB-GENE-942085 | Inparanoid, OMA, EggNOG |
| Zebrafish | 378960 | mgll | monoglyceride lipase | 7955 | ZDB-GENE-031006-9 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 853768 | YJU3 | acylglycerol lipase | 4932 | S000001577 | Inparanoid, OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.