224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Corrinoid adenosyltransferase |
|---|
Gene and Protein Information
| Gene ID | 326625 |
|---|---|
| Uniprot Accession IDs | Q96EY8 C5HU05 Q9BSH0 |
| Ensembl ID | ENSP00000445920 |
| Symbol | ATR cob cblB CFAP23 |
| Family | Belongs to the Cob(I)alamin adenosyltransferase family. |
| Sequence | MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452403 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 9598 | OMA, EggNOG | |
| Macaque | 708973 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 9544 | Inparanoid, OMA | |
| Mouse | 77697 | Mmab | methylmalonic aciduria (cobalamin deficiency) cblB type homolog (human) | 10090 | MGI:1924947 | Inparanoid, OMA, EggNOG |
| Rat | 687861 | Mmab | methylmalonic aciduria (cobalamin deficiency) cblB type | 10116 | RGD:1596242 | Inparanoid, OMA |
| Dog | 486310 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100066641 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 617636 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100157459 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100028469 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 13616 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 557077 | mmab | methylmalonic aciduria (cobalamin deficiency) cblB type | 7955 | ZDB-GENE-060526-232 | Inparanoid, OMA, EggNOG |
| C. elegans | 175661 | mmab-1 | MethylMalonic Aciduria type B homolog | 6239 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / oxidoreductase / dehydrogenase / Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
protein / oxidoreductase / dehydrogenase / Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
DTO Classes
protein / Enzyme / Oxidoreductase / Dehydrogenase / Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
protein / Enzyme / Oxidoreductase / Dehydrogenase / Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.