🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

DDX39B

DescripciónSpliceosome RNA helicase DDX39B

Gene and Protein Information

Gene ID7919
Uniprot Accession IDs Q13838 B0S8C0 O43496 Q0EFA1 Q2L6F9 Q53GL9 Q5RJ64 Q5RJ66 Q5ST94 Q5STB4 Q5STB5 Q5STB7 Q5STB8 Q5STU4 Q5STU5 Q5STU6 Q5STU8 Q71V76
Ensembl ID ENSP00000379475
Symbol BAT1 UAP56 BAT1 UAP56 D6S81E
FamilyBelongs to the DEAD box helicase family. DECD subfamily.
Sequence
MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp463180DDX39BDExD-box helicase 39B9598VGNC:52006Inparanoid, OMA
Macaque715233DDX39BDExD-box helicase 39B9544Inparanoid, OMA
Mouse53817Ddx39bDEAD (Asp-Glu-Ala-Asp) box polypeptide 39B10090MGI:99240Inparanoid, OMA
Rat114612Ddx39bDExD-box helicase 39B10116RGD:70923Inparanoid, OMA
Dog474839DDX39BDExD-box helicase 39B9615VGNC:39855Inparanoid, OMA
Horse100146384DDX39BDExD-box helicase 39B9796Inparanoid, OMA
Cow540191DDX39BDExD-box helicase 39B9913VGNC:27965Inparanoid, OMA
Pig448813DDX39BDExD-box helicase 39B9823Inparanoid, OMA
Anole lizard100553235ddx39bDExD-box helicase 39B28377Inparanoid, OMA
Zebrafish393917ddx39bDEAD (Asp-Glu-Ala-Asp) box polypeptide 39B7955ZDB-GENE-040426-1259Inparanoid, OMA
C. elegans174333hel-1Spliceosome RNA helicase DDX39B homolog6239Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.