🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

EEF1E1

DescripciónEukaryotic translation elongation factor 1 epsilon-1

Gene and Protein Information

Gene ID9521
Uniprot Accession IDs O43324 C9JLK5 Q5THS2
Ensembl ID ENSP00000369038
Symbol AIMP3 P18 P18 AIMP3
Sequence
MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp462423EEF1E1eukaryotic translation elongation factor 1 epsilon 19598OMA, EggNOG
Macaque695426EEF1E1eukaryotic translation elongation factor 1 epsilon 19544Inparanoid, OMA, EggNOG
Mouse66143Eef1e1eukaryotic translation elongation factor 1 epsilon 110090MGI:1913393Inparanoid, OMA, EggNOG
Rat291057Eef1e1eukaryotic translation elongation factor 1 epsilon 110116RGD:1311056Inparanoid, OMA, EggNOG
Dog478717EEF1E1eukaryotic translation elongation factor 1 epsilon 19615Inparanoid, OMA
Cow617105EEF1E1eukaryotic translation elongation factor 1 epsilon 19913Inparanoid, OMA
Chicken420865EEF1E1eukaryotic translation elongation factor 1 epsilon 19031CGNC:9688Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.