🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

LMAN1

DescripciónProtein ERGIC-53

Gene and Protein Information

Gene ID3998
Uniprot Accession IDs P49257 Q12895 Q8N5I7 Q9UQG1 Q9UQG2 Q9UQG3 Q9UQG4 Q9UQG5 Q9UQG6 Q9UQG7 Q9UQG8 Q9UQG9 Q9UQH0 Q9UQH1 Q9UQH2
Ensembl ID ENSP00000251047
Symbol ERGIC53 F5F8D MR60 gp58 F5F8D FMFD1 MCFD1 ERGIC53 ERGIC-53
Sequence
MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp455448LMAN1lectin, mannose binding 19598VGNC:10016OMA, EggNOG
Macaque697449LMAN1lectin, mannose binding 19544Inparanoid, OMA, EggNOG
Mouse70361Lman1lectin, mannose-binding, 110090MGI:1917611Inparanoid, OMA, EggNOG
Rat116666Lman1lectin, mannose-binding, 110116RGD:71020Inparanoid, OMA, EggNOG
Dog476186LMAN1lectin, mannose binding 19615VGNC:42706Inparanoid, OMA, EggNOG
Horse100050262LMAN1lectin, mannose binding 19796VGNC:19697Inparanoid, OMA, EggNOG
Cow511649LMAN1lectin, mannose binding 19913VGNC:30918Inparanoid, OMA, EggNOG
Pig100153007LMAN1lectin, mannose binding 19823OMA, EggNOG
Opossum100021881LMAN1lectin, mannose binding 113616Inparanoid, OMA, EggNOG
Platypus100086248LOC100086248protein ERGIC-539258OMA, EggNOG
Anole lizard100562643lman1lectin, mannose binding 128377Inparanoid, OMA, EggNOG
Xenopus100494337lman1lectin, mannose binding 18364XB-GENE-492680Inparanoid, OMA, EggNOG
Zebrafish559775lman1lectin, mannose-binding, 17955ZDB-GENE-060201-4Inparanoid, OMA, EggNOG
C. elegans172799ile-1Intracellular LEctin6239Inparanoid, OMA, EggNOG
Fruitfly44679ergic53CG6822 gene product from transcript CG6822-RB7227FBgn0035909Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.