🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

LAMTOR5

DescripciónRagulator complex protein LAMTOR5

Gene and Protein Information

Gene ID10542
Uniprot Accession IDs O43504 Q6IBD8
Ensembl ID ENSP00000256644
Symbol HBXIP XIP XIP HBXIP
FamilyBelongs to the LAMTOR5 family.
Sequence
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp457120LAMTOR5late endosomal/lysosomal adaptor, MAPK and MTOR activator 59598VGNC:8351OMA, EggNOG
Mouse68576Lamtor5late endosomal/lysosomal adaptor, MAPK and MTOR activator 510090MGI:1915826Inparanoid, EggNOG
Rat295357Lamtor5late endosomal/lysosomal adaptor, MAPK and MTOR activator 510116RGD:1305005Inparanoid, EggNOG
Horse106783217LAMTOR5late endosomal/lysosomal adaptor, MAPK and MTOR activator 59796VGNC:19577Inparanoid, OMA, EggNOG
Cow516090LAMTOR5late endosomal/lysosomal adaptor, MAPK and MTOR activator 59913Inparanoid, OMA, EggNOG
Opossum100033089LAMTOR5late endosomal/lysosomal adaptor, MAPK and MTOR activator 513616Inparanoid, OMA, EggNOG
Chicken419811LAMTOR5late endosomal/lysosomal adaptor, MAPK and MTOR activator 59031CGNC:250OMA, EggNOG
Anole lizard100564514lamtor5late endosomal/lysosomal adaptor, MAPK and MTOR activator 528377Inparanoid, OMA, EggNOG
Xenopus100135168lamtor5late endosomal/lysosomal adaptor, MAPK and MTOR activator 58364XB-GENE-950195Inparanoid, OMA, EggNOG
Zebrafish100333504lamtor5late endosomal/lysosomal adaptor, MAPK and MTOR activator 57955ZDB-GENE-110411-193Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.