🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

MAPRE3

DescripciónMicrotubule-associated protein RP/EB family member 3

Gene and Protein Information

Gene ID22924
Uniprot Accession IDs Q9UPY8 B7WPK5 O00265 Q6FHB0 Q6FI15 Q9BZP7 Q9BZP8
Ensembl ID ENSP00000233121
Symbol EB3 RP3 EBF3 EBF3-S
FamilyBelongs to the MAPRE family.
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque106992881MAPRE3microtubule associated protein RP/EB family member 39544Inparanoid, OMA, EggNOG
Mouse100732Mapre3microtubule-associated protein, RP/EB family, member 310090MGI:2140967Inparanoid, OMA, EggNOG
Rat298848Mapre3microtubule-associated protein, RP/EB family, member 310116RGD:1359297Inparanoid, OMA, EggNOG
Dog475694MAPRE3microtubule associated protein RP/EB family member 39615VGNC:43011Inparanoid, OMA, EggNOG
Horse100629914MAPRE3microtubule associated protein RP/EB family member 39796OMA, EggNOG
Horse100050599LOC100050599microtubule-associated protein RP/EB family member 39796Inparanoid, OMA
Cow528839MAPRE3microtubule associated protein RP/EB family member 39913VGNC:31234Inparanoid, OMA, EggNOG
Pig100524857MAPRE3microtubule associated protein RP/EB family member 39823OMA, EggNOG
Opossum100618640MAPRE3microtubule associated protein RP/EB family member 313616Inparanoid, EggNOG
Anole lizard100559494mapre3microtubule associated protein RP/EB family member 328377Inparanoid, OMA
Zebrafish431717mapre3bmicrotubule-associated protein, RP/EB family, member 3b7955ZDB-GENE-040704-6Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    non-motor microtubule binding protein    /    Microtubule-associated protein RP/EB family member 3
DTO Classes
protein    /    Cellular structure    /    Microtubule family cytoskeletal protein    /    Non-motor microtubule binding protein    /    Microtubule-associated protein RP/EB family member 3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.