🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

MT-CO2

DescripciónCytochrome c oxidase subunit 2

Gene and Protein Information

Gene ID4513
Uniprot Accession IDs P00403 Q37526
Ensembl ID ENSP00000354876
Symbol COII COX2 COXII MTCO2 COII MTCO2
FamilyBelongs to the cytochrome c oxidase subunit 2 family.
Sequence
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp807864MT-CO2mitochondrially encoded cytochrome c oxidase II9598VGNC:11715Inparanoid, OMA, EggNOG
Macaque2846628COX2cytochrome c oxidase subunit II9544OMA, EggNOG
Mouse17709mt-Co2mitochondrially encoded cytochrome c oxidase II10090MGI:102503Inparanoid, OMA, EggNOG
Rat26198Mt-co2mitochondrially encoded cytochrome c oxidase II10116RGD:621872Inparanoid, OMA, EggNOG
Dog804479MT-CO2mitochondrially encoded cytochrome c oxidase II9615VGNC:53137Inparanoid, OMA, EggNOG
Horse807845COX2cytochrome c oxidase subunit II9796Inparanoid, OMA, EggNOG
Cow3283880COX2cytochrome c oxidase subunit II9913Inparanoid, OMA, EggNOG
Pig808504COX2cytochrome c oxidase subunit II9823Inparanoid, OMA, EggNOG
Opossum3074663COX2cytochrome c oxidase subunit II13616OMA, EggNOG
Platypus808709COX2cytochrome c oxidase subunit II9258Inparanoid, EggNOG
Anole lizard6385975COX2cytochrome c oxidase subunit II28377Inparanoid, OMA, EggNOG
Xenopus3283495COX2cytochrome c oxidase subunit II8364Inparanoid, OMA
Zebrafish140540mt-co2cytochrome c oxidase II, mitochondrial7955ZDB-GENE-011205-15Inparanoid, OMA, EggNOG
C. elegans2565697COX2cytochrome c oxidase subunit II6239Inparanoid, OMA, EggNOG
Fruitfly19893535COX2cytochrome c oxidase subunit II7227FBgn0013675Inparanoid, EggNOG
S.cerevisiae854622COX2cytochrome c oxidase subunit 24932S000007281Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.