224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Lymphoid enhancer-binding factor 1 |
|---|
Gene and Protein Information
| Gene ID | 51176 |
|---|---|
| Uniprot Accession IDs | Q9UJU2 B4DG38 B7Z8E2 E9PDK3 Q3ZCU4 Q9HAZ0 LEF-1 |
| Ensembl ID | ENSP00000265165 |
| Symbol | LEF-1 TCF10 TCF7L3 TCF1ALPHA |
| Family | Belongs to the TCF/LEF family. |
| Sequence | MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461425 | LEF1 | lymphoid enhancer binding factor 1 | 9598 | VGNC:6477 | OMA, EggNOG |
| Macaque | 695776 | LEF1 | lymphoid enhancer binding factor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 16842 | Lef1 | lymphoid enhancer binding factor 1 | 10090 | MGI:96770 | Inparanoid, OMA, EggNOG |
| Rat | 161452 | Lef1 | lymphoid enhancer binding factor 1 | 10116 | RGD:620241 | Inparanoid, OMA, EggNOG |
| Dog | 478507 | LEF1 | lymphoid enhancer binding factor 1 | 9615 | VGNC:42630 | Inparanoid, OMA, EggNOG |
| Horse | 100072938 | LEF1 | lymphoid enhancer binding factor 1 | 9796 | VGNC:19627 | Inparanoid, OMA, EggNOG |
| Cow | 535399 | LEF1 | lymphoid enhancer binding factor 1 | 9913 | VGNC:30833 | Inparanoid, OMA, EggNOG |
| Pig | 100170126 | LEF1 | lymphoid enhancer binding factor 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100011783 | LEF1 | lymphoid enhancer binding factor 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100556215 | lef1 | lymphoid enhancer binding factor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100493178 | lef1 | lymphoid enhancer binding factor 1 | 8364 | XB-GENE-485517 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30701 | lef1 | lymphoid enhancer-binding factor 1 | 7955 | ZDB-GENE-990714-26 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.